Comparing 8502466 FitnessBrowser__Miya:8502466 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3gueA Crystal structure of udp-glucose phosphorylase from trypanosoma brucei, (tb10.389.0330)
45% identity, 97% coverage: 12:465/467 of query aligns to 10:464/468 of 3gueA
5nzmA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with murrayamine-i
42% identity, 97% coverage: 7:461/467 of query aligns to 8:476/483 of 5nzmA
5nzlA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with resveratrol
42% identity, 97% coverage: 7:461/467 of query aligns to 8:476/483 of 5nzlA
5nzkA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with phenylalanine
42% identity, 97% coverage: 7:461/467 of query aligns to 8:476/483 of 5nzkA
4m28A Udp-glucose pyrophosphorylase from leishmania major in complex with utp analog dupcpp
42% identity, 97% coverage: 7:461/467 of query aligns to 8:476/483 of 4m28A
2oegA Open and closed structures of the udp-glucose pyrophosphorylase from leishmania major (see paper)
42% identity, 97% coverage: 7:461/467 of query aligns to 7:475/482 of 2oegA
P32861 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 97% coverage: 14:465/467 of query aligns to 44:489/499 of P32861
P78811 Probable UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 98% coverage: 8:463/467 of query aligns to 47:494/506 of P78811
Sites not aligning to the query:
P19595 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Solanum tuberosum (Potato) (see 2 papers)
41% identity, 83% coverage: 80:466/467 of query aligns to 93:472/477 of P19595
Sites not aligning to the query:
2icyB Crystal structure of a putative udp-glucose pyrophosphorylase from arabidopsis thaliana with bound udp-glucose (see paper)
40% identity, 82% coverage: 80:463/467 of query aligns to 80:454/463 of 2icyB
Sites not aligning to the query:
Q9M9P3 UTP--glucose-1-phosphate uridylyltransferase 2; UDP-glucose pyrophosphorylase 2; AtUGP2; UDPGP 2; UGPase 2; EC 2.7.7.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 82% coverage: 80:463/467 of query aligns to 86:460/469 of Q9M9P3
Sites not aligning to the query:
2icxA Crystal structure of a putative udp-glucose pyrophosphorylase from arabidopsis thaliana with bound utp (see paper)
40% identity, 82% coverage: 80:463/467 of query aligns to 74:446/455 of 2icxA
Sites not aligning to the query:
Q16851 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Homo sapiens (Human) (see 6 papers)
37% identity, 89% coverage: 50:465/467 of query aligns to 76:498/508 of Q16851
Sites not aligning to the query:
4r7pB Human udp-glucose pyrophosphorylase isoform 1 in complex with udp- glucose (see paper)
37% identity, 89% coverage: 50:465/467 of query aligns to 53:475/485 of 4r7pB
4r7pA Human udp-glucose pyrophosphorylase isoform 1 in complex with udp- glucose (see paper)
37% identity, 89% coverage: 50:465/467 of query aligns to 53:475/485 of 4r7pA
>8502466 FitnessBrowser__Miya:8502466
MCTVPLQPFATKMARAGLPSPLVALFASYLEELACGSTGLIPESDILPVGRDDLPLLDDL
APYAAIGRARLREAACIKLNGGLGTSMGMTHAKSLLPAKDGATFLELIVRQAEHQRRTHG
GPSPLLFMNSFSTHQDTLRALDVLGLQHAGRPGTFLQHRFPKVSRATLLPVEYPENPDLE
WNPPGHGDLYAALALSGHLARLLESGRRYALISNADNLGATLDPAILGYLMEEDIPFLME
CAPRTPSDRKGGHLARSRHGGLVLRELAQCPDDDLPRFQDIVRYGLFNTNNIWLDLRALR
QHIDEYGLLRLPMIRNPKTVNPRDPDSEKVWQVETAMGAAISLFPRARAIVTRRERFLPV
KKCSDLLVLWSDRTLLEPGGHVRPNPACTTPGVLVELDGAHYGTWDRLMARFPHGAPSLL
HCDALAVHGDVLFGGNVTARGRVVVRNPSCMQAVIPHGTVLEGDVNL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory