SitesBLAST
Comparing ABZR87_RS02730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cd16 phikz014 (see paper)
79% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 8cd16
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), A5 (= A5), S6 (= S6), V7 (= V7), I16 (= I16), I17 (= I17), R19 (= R19), D20 (≠ K20), R24 (= R24), R32 (= R32), K34 (= K34), R36 (= R36), Q37 (= Q37), G38 (= G38)
7unr8 30S ribosomal protein S6
79% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 7unr8
- binding zinc ion: C27 (= C27), H33 (= H33)
- binding : M1 (= M1), R4 (≠ L4), A5 (= A5), S6 (= S6), K15 (= K15), I16 (= I16), R19 (= R19), D20 (≠ K20), R24 (= R24), R32 (= R32), K34 (= K34), R36 (= R36), Q37 (= Q37), G38 (= G38)
8a3l3 50S ribosomal protein L36 (see paper)
76% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 8a3l3
- binding zinc ion: C11 (= C11), C27 (= C27), H33 (= H33)
- binding : M1 (= M1), K2 (= K2), V3 (= V3), R4 (≠ L4), A5 (= A5), S6 (= S6), V7 (= V7), K8 (= K8), R19 (= R19), R24 (= R24), K32 (≠ R32), K34 (= K34), R36 (= R36), Q37 (= Q37), G38 (= G38)
6yst4 of the P+9 ArfB-ribosome complex with P/E hybrid tRNA in the post-hydrolysis state (see paper)
76% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 6yst4
- binding magnesium ion: S6 (= S6), V7 (= V7), K8 (= K8)
- binding zinc ion: C11 (= C11), C27 (= C27), H33 (= H33)
- binding : M1 (= M1), K2 (= K2), V3 (= V3), A5 (= A5), S6 (= S6), V7 (= V7), K8 (= K8), K15 (= K15), I16 (= I16), K18 (= K18), R19 (= R19), D20 (≠ K20), R24 (= R24), K32 (≠ R32), K34 (= K34), Q37 (= Q37), G38 (= G38)
7m4v3 A. Baumannii ribosome-eravacycline complex: 50s (see paper)
74% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 7m4v3
- binding zinc ion: C27 (= C27), H33 (= H33)
- binding : M1 (= M1), K2 (= K2), S6 (= S6), V7 (= V7), R18 (≠ K18), R19 (= R19), N20 (≠ K20), R24 (= R24), K34 (= K34), R36 (= R36), Q37 (= Q37), G38 (= G38)
8rd8ep Small ribosomal subunit protein uS5 (see paper)
66% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 8rd8ep
- binding : M1 (= M1), K2 (= K2), A5 (= A5), S6 (= S6), V7 (= V7), K8 (= K8), K15 (= K15), R18 (≠ K18), R19 (= R19), K20 (= K20), P31 (= P31), R32 (= R32), K34 (= K34), R36 (= R36), Q37 (= Q37)
4v61B6 Ribosomal Protein S8 (see paper)
63% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 4v61B6
- binding : M1 (= M1), V3 (= V3), R4 (≠ L4), S5 (≠ A5), S6 (= S6), K8 (= K8), M10 (≠ I10), K15 (= K15), R19 (= R19), P31 (= P31), K32 (≠ R32), R36 (= R36), Q37 (= Q37)
7nhk8 50S ribosomal protein L36 (see paper)
63% identity, 100% coverage: 1:38/38 of query aligns to 1:38/38 of 7nhk8
- binding zinc ion: C27 (= C27), H33 (= H33)
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), P5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), M10 (≠ I10), R18 (≠ K18), R19 (= R19), K20 (= K20), R22 (≠ V22), K32 (≠ R32), R36 (= R36), Q37 (= Q37), G38 (= G38)
7ood2 Mycoplasma pneumoniae 50s subunit of ribosomes in chloramphenicol- treated cells (see paper)
71% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 7ood2
- binding zinc ion: C11 (= C11), C27 (= C27), H32 (= H33)
- binding : M1 (= M1), K2 (= K2), V3 (= V3), R4 (≠ L4), A5 (= A5), S6 (= S6), V7 (= V7), I10 (= I10), R19 (= R19), K31 (≠ R32), K33 (= K34), R35 (= R36), Q36 (= Q37)
1vy4B9 50S ribosomal protein L36 (see paper)
68% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 1vy4B9
- binding zinc ion: C11 (= C11), C14 (= C14), C27 (= C27), H32 (= H33)
- binding : M1 (= M1), K2 (= K2), V3 (= V3), R4 (≠ L4), A5 (= A5), S6 (= S6), V7 (= V7), K8 (= K8), R9 (= R9), K15 (= K15), V16 (≠ I16), R18 (≠ K18), R19 (= R19), H20 (≠ K20), R22 (≠ V22), K31 (≠ R32), K33 (= K34), R35 (= R36), Q36 (= Q37), G37 (= G38)
1dfeA Nmr structure of ribosomal protein l36 from thermus thermophilus (see paper)
68% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 1dfeA
P80256 Large ribosomal subunit protein bL36; 50S ribosomal protein L36; Ribosomal protein B from Thermus thermophilus (see paper)
68% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of P80256
- C11 (= C11) binding Zn(2+)
- C14 (= C14) binding Zn(2+)
- C27 (= C27) binding Zn(2+)
- H32 (= H33) binding Zn(2+)
5li08 50S ribosomal protein L36 (see paper)
68% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 5li08
- binding zinc ion: C27 (= C27), H32 (= H33)
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), P5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), I10 (= I10), K18 (= K18), R19 (= R19), K31 (≠ R32), K33 (= K34), R35 (= R36), Q36 (= Q37)
5o61f complete structure of the Mycobacterium smegmatis 70S ribosome (see paper)
68% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 5o61f
- binding zinc ion: C11 (= C11), H32 (= H33)
- binding : M1 (= M1), N4 (≠ L4), P5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), I10 (= I10), R19 (= R19), H20 (≠ K20), R22 (≠ V22), R31 (= R32), K33 (= K34), R35 (= R36), Q36 (= Q37), G37 (= G38)
9c4g3 Cutibacterium acnes 50s ribosomal subunit with clindamycin bound (see paper)
66% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 9c4g3
- binding : M1 (= M1), K2 (= K2), V3 (= V3), P5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), I10 (= I10), R19 (= R19), H20 (≠ K20), V23 (= V23), P30 (= P31), R31 (= R32), K33 (= K34), R35 (= R36), Q36 (= Q37)
4v8hB9 structure of HPF bound to the 70S ribosome. (see paper)
68% identity, 97% coverage: 2:38/38 of query aligns to 1:36/36 of 4v8hB9
- binding magnesium ion: K1 (= K2), Q33 (= Q35)
- binding zinc ion: C10 (= C11), C13 (= C14), C26 (= C27), H31 (= H33)
- binding : K1 (= K2), R3 (≠ L4), A4 (= A5), S5 (= S6), V6 (= V7), K7 (= K8), R8 (= R9), K14 (= K15), V15 (≠ I16), R17 (≠ K18), R18 (= R19), H19 (≠ K20), R21 (≠ V22), K30 (≠ R32), K32 (= K34), R34 (= R36), Q35 (= Q37), G36 (= G38)
7as8j Bacillus subtilis ribosome quality control complex state b. Ribosomal 50s subunit with p-tRNA, rqch, and rqcp/yabo (see paper)
63% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 7as8j
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), P5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), R18 (≠ K18), R19 (= R19), K20 (= K20), P30 (= P31), K31 (≠ R32), K35 (≠ R36), Q36 (= Q37), G37 (= G38)
3cf54 Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans (see paper)
61% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 3cf54
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), S5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), K9 (≠ R9), K15 (= K15), V16 (≠ I16), R18 (≠ K18), R19 (= R19), H20 (≠ K20), V23 (= V23), V30 (≠ P31), K31 (≠ R32), R35 (= R36), Q36 (= Q37)
2zjp4 Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans (see paper)
61% identity, 100% coverage: 1:38/38 of query aligns to 1:37/37 of 2zjp4
- binding zinc ion: M10 (≠ I10), C11 (= C11), H32 (= H33)
- binding : M1 (= M1), K2 (= K2), R4 (≠ L4), S5 (≠ A5), S6 (= S6), V7 (= V7), K8 (= K8), K9 (≠ R9), K15 (= K15), V17 (≠ I17), R18 (≠ K18), R19 (= R19), H20 (≠ K20), V30 (≠ P31), K31 (≠ R32), R35 (= R36), Q36 (= Q37)
6ywx0 structure of the mitoribosome from Neurospora crassa with tRNA bound to the E-site (see paper)
45% identity, 100% coverage: 1:38/38 of query aligns to 1:44/46 of 6ywx0
- binding magnesium ion: K20 (= K20), Y30 (≠ R24)
- binding zinc ion: C11 (= C11), C33 (= C27), H39 (= H33)
- binding : M1 (= M1), K2 (= K2), V3 (= V3), S5 (≠ A5), A6 (≠ S6), I7 (≠ V7), K8 (= K8), K15 (= K15), V17 (≠ I17), R18 (≠ K18), R19 (= R19), K20 (= K20), N26 (vs. gap), Y28 (≠ V22), Y30 (≠ R24), R38 (= R32), K40 (= K34), R42 (= R36), Q43 (= Q37), G44 (= G38)
Sites not aligning to the query:
Query Sequence
>ABZR87_RS02730
MKVLASVKRICRNCKIIKRKGVVRVICSTDPRHKQRQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory