Comparing AMB_RS19300 FitnessBrowser__Magneto:AMB_RS19300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
31% identity, 91% coverage: 7:306/329 of query aligns to 8:329/364 of P97084
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
30% identity, 91% coverage: 7:306/329 of query aligns to 2:323/356 of 1lc8A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
30% identity, 91% coverage: 7:306/329 of query aligns to 1:322/355 of 1lkcA
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
30% identity, 91% coverage: 7:306/329 of query aligns to 5:326/358 of 1lc7A
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
29% identity, 89% coverage: 32:323/329 of query aligns to 50:345/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
29% identity, 95% coverage: 10:323/329 of query aligns to 4:331/335 of 1geyA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 95% coverage: 10:323/329 of query aligns to 6:345/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 95% coverage: 10:323/329 of query aligns to 6:345/354 of 1fg3A
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 89% coverage: 10:302/329 of query aligns to 5:310/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
24% identity, 89% coverage: 10:302/329 of query aligns to 6:311/335 of 2f8jA
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
26% identity, 53% coverage: 54:229/329 of query aligns to 81:276/392 of P0DV65
Sites not aligning to the query:
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
24% identity, 83% coverage: 31:302/329 of query aligns to 20:305/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
24% identity, 83% coverage: 31:302/329 of query aligns to 20:305/329 of 1h1cA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
24% identity, 83% coverage: 31:302/329 of query aligns to 19:304/328 of 1uu0A
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 61% coverage: 103:302/329 of query aligns to 101:321/354 of 3ly1D
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
31% identity, 59% coverage: 132:326/329 of query aligns to 164:358/369 of 4r8dA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
24% identity, 89% coverage: 11:303/329 of query aligns to 37:331/360 of 8bj3A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
28% identity, 57% coverage: 44:229/329 of query aligns to 48:250/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
28% identity, 57% coverage: 44:229/329 of query aligns to 48:250/353 of 4r2nA
Sites not aligning to the query:
Q0ZQ41 CMP-5'-(3-aminopropyl)phosphonate synthase; EC 2.7.7.-; EC 4.1.1.- from Streptomyces rubellomurinus (strain ATCC 31215) (see paper)
32% identity, 53% coverage: 62:234/329 of query aligns to 324:505/628 of Q0ZQ41
Sites not aligning to the query:
>AMB_RS19300 FitnessBrowser__Magneto:AMB_RS19300
MTDLPLHGGDLAAAQARWGHPAQGWLDLSTGINPWPYPLPELPSDCWRRLPESGRHQALL
AVAARRWSVPANARVVAGSGSQALIQALPRITPPTEIAILGPTYGEHARAWSAAGHRVRD
VAGLQEAAASPVVVVVNPNNPDGRVVAPEDLLDLAARQAARGGLLVVDEAFGDERPELSL
TSRLGPGLVVLRSFGKFFGLAGIRLGFAVAEEGLAARLTDHLGPWPVSGPAIELGAQALA
DRVWTEATITRLRDAAARLGDILTRTGLEDLGGTFLFRLARHHQAPALYERLGRAGILVR
AFAFRPDILRFGLPGSEADEQRLRATLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory