Comparing AO353_00400 FitnessBrowser__pseudo3_N2E3:AO353_00400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 33% coverage: 75:217/433 of query aligns to 92:219/582 of O23492
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
27% identity, 43% coverage: 41:227/433 of query aligns to 50:225/457 of 5c65A
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
27% identity, 43% coverage: 41:227/433 of query aligns to 51:226/468 of 7spsA
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
27% identity, 43% coverage: 41:227/433 of query aligns to 52:227/469 of 7crzA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
27% identity, 43% coverage: 41:227/433 of query aligns to 54:229/470 of 4zw9A
Sites not aligning to the query:
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
27% identity, 43% coverage: 41:227/433 of query aligns to 54:229/496 of P11169
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
27% identity, 43% coverage: 41:227/433 of query aligns to 54:229/470 of 7sptA
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 70% coverage: 65:366/433 of query aligns to 50:385/437 of 6rw3A
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
24% identity, 41% coverage: 51:229/433 of query aligns to 65:241/493 of P32037
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 69% coverage: 70:366/433 of query aligns to 70:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 69% coverage: 70:366/433 of query aligns to 70:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 69% coverage: 70:366/433 of query aligns to 70:407/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 69% coverage: 70:366/433 of query aligns to 74:411/491 of P0AGF4
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 50% coverage: 7:222/433 of query aligns to 37:234/444 of Q8NLB7
Sites not aligning to the query:
>AO353_00400 FitnessBrowser__pseudo3_N2E3:AO353_00400
MASTTGKGKAIFRVVSGNFLEMFDFMVYGFYATAIAKTFFPADSAFASLMLSLATFGAGF
LMRPLGAIFLGAYIDRHGRRKGLIITLALMAAGTVLIACVPGYATLGVAAPLIVLFGRLL
QGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQAAVVFAGLLGVGLNHWLSPEQMG
DWGWRVPFLVGCMIVPAIFIIRRSLEETPEFQARKHRPSLRDIVRSISQNFGIVLAGMAL
VVMTTVSFYLITAYTPTFGKAELHLSDFDALLVTVCIGLSNFFWLPVMGALSDKIGRKPL
LLAATILAILTAYPALSWLVANPSFSHLLIVELWLSFLYGSYNGAMVVALTEIMPIEVRT
TGFSLAYSLATATFGGFTPAACTYLIHVLDNKAAPGIWLSGAAVLGLIATLVLFRGNRHE
LRTAQAAVVGGTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory