SitesBLAST
Comparing AO353_00900 FitnessBrowser__pseudo3_N2E3:AO353_00900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6t4vC Crystal structure of 2-methylisocitrate lyase (prpb) from pseudomonas aeruginosa in apo form.
87% identity, 96% coverage: 7:292/297 of query aligns to 3:277/277 of 6t4vC
- active site: Y41 (= Y45), S43 (= S47), G44 (= G48), G45 (= G49), D56 (= D60), D83 (= D87), D85 (= D89), H111 (= H115), E113 (= E117), R145 (= R160), E175 (= E190), N197 (= N212), T204 (= T219), L206 (= L221)
- binding pyruvic acid: F88 (= F92), N94 (= N98)
Q56062 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
76% identity, 98% coverage: 7:296/297 of query aligns to 5:294/295 of Q56062
- SGG 45:47 (= SGG 47:49) binding
- D58 (= D60) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- D85 (= D87) binding
- K121 (= K123) mutation to A: 1000-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R122 (= R124) mutation to K: 2-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- C123 (= C125) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- H125 (= H127) mutation to A: 750-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R158 (= R160) binding
P77541 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Escherichia coli (strain K12) (see 3 papers)
74% identity, 98% coverage: 7:296/297 of query aligns to 5:294/296 of P77541
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1mumA Structure of the 2-methylisocitrate lyase (prpb) from escherichia coli (see paper)
75% identity, 97% coverage: 7:293/297 of query aligns to 3:289/289 of 1mumA
- active site: Y41 (= Y45), S43 (= S47), G44 (= G48), G45 (= G49), D56 (= D60), D83 (= D87), D85 (= D89), H111 (= H115), E113 (= E117), K119 (= K123), C121 (= C125), G122 (= G126), H123 (= H127), R156 (= R160), E186 (= E190), N208 (= N212), T215 (= T219), L217 (= L221)
- binding magnesium ion: D56 (= D60), D85 (= D89)
1o5qA Crystal structure of pyruvate and mg2+ bound 2-methylisocitrate lyase (prpb) from salmonella typhimurium (see paper)
73% identity, 95% coverage: 7:288/297 of query aligns to 1:271/271 of 1o5qA
- active site: Y39 (= Y45), S41 (= S47), G42 (= G48), G43 (= G49), D54 (= D60), D81 (= D87), D83 (= D89), H109 (= H115), E111 (= E117), R143 (= R160), E173 (= E190), N195 (= N212), T202 (= T219), L204 (= L221)
- binding pyruvic acid: Y39 (= Y45), S41 (= S47), G43 (= G49), D81 (= D87), R143 (= R160)
4iqdA Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis
45% identity, 96% coverage: 3:286/297 of query aligns to 4:283/290 of 4iqdA
- active site: Y46 (= Y45), S48 (= S47), G49 (= G48), A50 (≠ G49), D60 (= D60), D87 (= D87), D89 (= D89), Q114 (≠ H115), E116 (= E117), K122 (= K123), C124 (= C125), G125 (= G126), H126 (= H127), R157 (= R160), E187 (= E190), N209 (= N212)
- binding pyruvic acid: E71 (≠ T71), R72 (≠ D72), D75 (≠ R75), G165 (= G168), L166 (= L169), Y218 (≠ L221), Y219 (= Y222)
Q05957 Petal death protein; (R)-2-methylmalate lyase; D-citramalate lyase; Oxalacetic hydrolase; PSR132; EC 3.7.1.1; EC 4.1.3.- from Dianthus caryophyllus (Carnation) (Clove pink) (see 2 papers)
35% identity, 87% coverage: 26:284/297 of query aligns to 45:303/318 of Q05957
- D79 (= D60) mutation to A: Reduces catalytic efficiency 1000-fold.
- D107 (≠ V88) binding
- D109 (≠ T90) binding
- K142 (= K123) binding
- C144 (= C125) mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 1:3 modified: propeptide, Removed in mature form
1zlpA Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
35% identity, 87% coverage: 26:284/297 of query aligns to 18:276/284 of 1zlpA
- active site: F37 (≠ Y45), S39 (= S47), G40 (= G48), Y41 (≠ G49), D52 (= D60), D80 (≠ V88), D82 (≠ T90), F107 (≠ H115), E109 (= E117), K115 (= K123), C117 (= C125), G118 (= G126), H119 (= H127), R152 (= R160), E182 (= E190), N204 (= N212), T211 (= T219), L213 (= L221)
- binding 5-hydroxypentanal: C117 (= C125), G118 (= G126), R152 (= R160), I206 (≠ T214)
- binding magnesium ion: D80 (≠ V88), K115 (= K123)
1zlpB Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
35% identity, 87% coverage: 26:284/297 of query aligns to 18:276/285 of 1zlpB
- active site: F37 (≠ Y45), S39 (= S47), G40 (= G48), Y41 (≠ G49), D52 (= D60), D80 (≠ V88), D82 (≠ T90), F107 (≠ H115), E109 (= E117), K115 (= K123), C117 (= C125), G118 (= G126), H119 (= H127), R152 (= R160), E182 (= E190), N204 (= N212), T211 (= T219), L213 (= L221)
- binding 5-hydroxypentanal: Y41 (≠ G49), C117 (= C125), R152 (= R160), I206 (≠ T214)
3fa3B Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form (see paper)
37% identity, 79% coverage: 26:260/297 of query aligns to 24:261/302 of 3fa3B
- active site: Y43 (= Y45), T45 (≠ S47), G46 (= G48), A47 (≠ G49), D58 (= D60), D86 (= D87), D88 (= D89), H113 (= H115), E115 (= E117), K121 (= K123), C123 (= C125), G124 (= G126), H125 (= H127), R160 (= R160), E190 (= E190), N213 (= N212), T220 (= T219), S222 (≠ L221)
- binding 2,2-difluoro-3,3-dihydroxybutanedioic acid: Y43 (= Y45), T45 (≠ S47), G46 (= G48), A47 (≠ G49), D86 (= D87), G124 (= G126), R160 (= R160), E190 (= E190), N213 (= N212), P239 (= P238)
3m0jA Structure of oxaloacetate acetylhydrolase in complex with the inhibitor 3,3-difluorooxalacetate (see paper)
35% identity, 79% coverage: 26:260/297 of query aligns to 25:263/297 of 3m0jA
- binding calcium ion: E218 (= E215), N219 (≠ F216)
- binding 2,2-difluoro-3,3-dihydroxybutanedioic acid: Y44 (= Y45), T46 (≠ S47), G47 (= G48), A48 (≠ G49), D88 (= D87), G126 (= G126), R162 (= R160), E192 (= E190), N215 (= N212), S241 (≠ P238)
3fa4A Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form (see paper)
35% identity, 79% coverage: 26:260/297 of query aligns to 24:254/284 of 3fa4A
- active site: Y43 (= Y45), T45 (≠ S47), G46 (= G48), A47 (≠ G49), D58 (= D60), D86 (= D87), D88 (= D89), H113 (= H115), E115 (= E117), R153 (= R160), E183 (= E190), N206 (= N212), T213 (= T219), S215 (≠ L221)
- binding magnesium ion: D86 (= D87), D88 (= D89)
3fa3J Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form (see paper)
35% identity, 79% coverage: 26:260/297 of query aligns to 23:252/292 of 3fa3J
- active site: Y42 (= Y45), T44 (≠ S47), G45 (= G48), A46 (≠ G49), D57 (= D60), D85 (= D87), D87 (= D89), H112 (= H115), E114 (= E117), R151 (= R160), E181 (= E190), N204 (= N212), T211 (= T219), S213 (≠ L221)
- binding manganese (ii) ion: D85 (= D87), D87 (= D89)
3m0kA Structure of oxaloacetate acetylhydrolase in complex with the product oxalate (see paper)
34% identity, 79% coverage: 26:260/297 of query aligns to 25:258/289 of 3m0kA
Q84G06 Phosphonopyruvate hydrolase; PPH; EC 3.11.1.3 from Variovorax sp. (strain Pal2) (see paper)
36% identity, 87% coverage: 7:265/297 of query aligns to 2:262/290 of Q84G06
- D81 (= D87) binding
- R188 (= R204) mutation to A: Reduced affinity for substrate.
2hjpA Crystal structure of phosphonopyruvate hydrolase complex with phosphonopyruvate and mg++ (see paper)
36% identity, 87% coverage: 7:265/297 of query aligns to 2:255/283 of 2hjpA
- active site: W40 (≠ Y45), S42 (= S47), G43 (= G48), F44 (≠ G49), D54 (= D60), D81 (= D87), D83 (= D89), V108 (≠ H115), E110 (= E117), K116 (= K123), T118 (≠ C125), R148 (= R160), H179 (≠ A202), V204 (≠ T224)
- binding phosphonopyruvate: W40 (≠ Y45), S42 (= S47), F44 (≠ G49), D81 (= D87), R148 (= R160), H179 (≠ A202), R181 (= R204)
- binding alpha-D-xylopyranose: E32 (≠ K37), S75 (≠ D81)
2duaA Crystal structure of phosphonopyruvate hydrolase complex with oxalate and mg++ (see paper)
36% identity, 87% coverage: 7:265/297 of query aligns to 2:255/283 of 2duaA
- active site: W40 (≠ Y45), S42 (= S47), G43 (= G48), F44 (≠ G49), D54 (= D60), D81 (= D87), D83 (= D89), V108 (≠ H115), E110 (= E117), K116 (= K123), T118 (≠ C125), R148 (= R160), H179 (≠ A202), V204 (≠ T224)
- binding oxalate ion: W40 (≠ Y45), S42 (= S47), F44 (≠ G49), D81 (= D87), R148 (= R160)
- binding alpha-D-xylopyranose: E32 (≠ K37), S75 (≠ D81)
1pymA Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate (see paper)
30% identity, 84% coverage: 29:276/297 of query aligns to 24:272/291 of 1pymA
- active site: W40 (≠ Y45), S42 (= S47), G43 (= G48), L44 (≠ G49), D54 (= D60), D81 (= D87), D83 (= D89), C108 (≠ H115), E110 (= E117), K116 (= K123), N118 (≠ C125), S119 (≠ G126), R155 (= R160), H186 (≠ E190), V211 (≠ N212)
- binding oxalate ion: W40 (≠ Y45), S42 (= S47), G43 (= G48), L44 (≠ G49), D81 (= D87), R155 (= R160)
1m1bA Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate (see paper)
30% identity, 84% coverage: 29:276/297 of query aligns to 24:272/291 of 1m1bA
- active site: W40 (≠ Y45), S42 (= S47), G43 (= G48), L44 (≠ G49), D54 (= D60), D81 (= D87), D83 (= D89), C108 (≠ H115), E110 (= E117), K116 (= K123), N118 (≠ C125), S119 (≠ G126), R155 (= R160), H186 (≠ E190), V211 (≠ N212)
- binding magnesium ion: D81 (= D87), R155 (= R160)
- binding sulfopyruvate: S42 (= S47), G43 (= G48), L44 (≠ G49), D81 (= D87), N118 (≠ C125), S119 (≠ G126), L120 (≠ H127), R155 (= R160)
P56839 Phosphoenolpyruvate phosphomutase; PEP mutase; PEP phosphomutase; Phosphoenolpyruvate mutase; EC 5.4.2.9 from Mytilus edulis (Blue mussel) (see 2 papers)
30% identity, 84% coverage: 29:276/297 of query aligns to 28:276/295 of P56839
- D58 (= D60) mutation D->A,S: Abolishes enzyme activity.; mutation to N: Strongly reduces enzyme activity.
- D85 (= D87) mutation to A: Strongly reduces enzyme activity and increases KM.
- D87 (= D89) mutation to A: Strongly reduces enzyme activity.
- E114 (= E117) mutation to A: Strongly reduces enzyme activity.
- N122 (≠ C125) mutation N->A,D: Strongly reduces enzyme activity.
- R159 (= R160) mutation to A: Strongly reduces enzyme activity.
- H190 (≠ E190) mutation to A: Strongly reduces enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>AO353_00900 FitnessBrowser__pseudo3_N2E3:AO353_00900
MSSNKSTPGQRFRDAVASEHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAGSLGVPD
LGITGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVARTVKSMIKFGAAAIHIEDQV
GAKRCGHRPNKEIVSQQEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACI
EAGADMVFPEAITELDMYKLFASRVKAPILANITEFGATPLYTTEQLKAADVSLVLYPLS
AFRAMNKAAENVYTAIRRDGTQQNVIDTMQTRMELYDRIDYHTFEQKLDALFAQKKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory