Comparing AO353_00930 FitnessBrowser__pseudo3_N2E3:AO353_00930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q9I2Y2 Phosphoserine phosphatase ThrH; PSP; PSPase; EC 3.1.3.3 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
86% identity, 100% coverage: 1:205/205 of query aligns to 1:205/205 of Q9I2Y2
1rkvA Structure of phosphate complex of thrh from pseudomonas aeruginosa (see paper)
86% identity, 100% coverage: 1:205/205 of query aligns to 2:206/206 of 1rkvA
1rkuA Crystal structure of thrh gene product of pseudomonas aeruginosa (see paper)
86% identity, 100% coverage: 1:205/205 of query aligns to 2:206/206 of 1rkuA
4ap9A Crystal structure of phosphoserine phosphatase from t.Onnurineus in complex with ndsb-201 (see paper)
32% identity, 87% coverage: 2:180/205 of query aligns to 10:180/200 of 4ap9A
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
26% identity, 75% coverage: 20:172/205 of query aligns to 22:176/200 of 1l7oA
Sites not aligning to the query:
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
26% identity, 75% coverage: 20:172/205 of query aligns to 22:184/208 of 1l7pA
Sites not aligning to the query:
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
26% identity, 75% coverage: 20:172/205 of query aligns to 25:187/211 of Q58989
Sites not aligning to the query:
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
26% identity, 75% coverage: 20:172/205 of query aligns to 24:186/210 of 1f5sA
Sites not aligning to the query:
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
26% identity, 75% coverage: 20:172/205 of query aligns to 23:185/209 of 1l7nA
Sites not aligning to the query:
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
31% identity, 69% coverage: 30:171/205 of query aligns to 214:360/409 of O53289
Sites not aligning to the query:
>AO353_00930 FitnessBrowser__pseudo3_N2E3:AO353_00930
VEIACLDLEGVLVPEIWIAFAEKTGIESLKATTRDIPDYDVLMQQRLRILDEHDLKLSDI
QEVIATLKPLDGAIEFVNWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHRLITDDTG
RVTGYQLRQKDPKRQSVLSFKSLYYRVIAAGDSYNDTSMLGEADAGILFHAPDNVIREFP
QFPAVHSFAELKQEFLKASNRELSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory