Comparing AO353_01060 FitnessBrowser__pseudo3_N2E3:AO353_01060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3vzsB Crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and NADP (see paper)
66% identity, 100% coverage: 1:234/235 of query aligns to 15:248/249 of 3vzsB
Sites not aligning to the query:
P14697 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
66% identity, 100% coverage: 1:234/235 of query aligns to 12:245/246 of P14697
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
67% identity, 100% coverage: 1:234/235 of query aligns to 11:244/245 of 5vmlA
Sites not aligning to the query:
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
52% identity, 100% coverage: 1:235/235 of query aligns to 10:245/245 of 4k6fB
Sites not aligning to the query:
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
50% identity, 100% coverage: 1:234/235 of query aligns to 10:244/245 of 5vt6A
Sites not aligning to the query:
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 16:243/244 of 6t77A
Sites not aligning to the query:
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 16:243/244 of P0A2C9
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 19:246/247 of 3op4A
Sites not aligning to the query:
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 15:242/243 of 1q7bA
Sites not aligning to the query:
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
47% identity, 99% coverage: 3:234/235 of query aligns to 16:243/244 of P0AEK2
Sites not aligning to the query:
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 15:242/243 of 1q7cA
Sites not aligning to the query:
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
46% identity, 99% coverage: 3:234/235 of query aligns to 23:253/254 of 4ag3A
Sites not aligning to the query:
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 19:242/243 of 4i08A
Sites not aligning to the query:
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
47% identity, 99% coverage: 3:234/235 of query aligns to 29:254/255 of 4bo4C
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
45% identity, 99% coverage: 3:234/235 of query aligns to 15:242/243 of 7emgB
Sites not aligning to the query:
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
45% identity, 99% coverage: 3:234/235 of query aligns to 18:240/241 of 4bnzA
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
44% identity, 99% coverage: 3:234/235 of query aligns to 17:238/239 of 4bnyA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
44% identity, 99% coverage: 3:234/235 of query aligns to 18:239/239 of 4bnxA
4bo8A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-amino-4- phenylimidazol-1-yl)-3-(2-fluorophenyl)urea at 2.7a resolution (see paper)
44% identity, 99% coverage: 3:234/235 of query aligns to 18:235/236 of 4bo8A
4bo0A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(4-methoxy-1- methylindazol-3-yl)-3-(2-methoxyphenyl)urea at 2.4a resolution (see paper)
44% identity, 99% coverage: 3:234/235 of query aligns to 17:234/235 of 4bo0A
>AO353_01060 FitnessBrowser__pseudo3_N2E3:AO353_01060
MGGIGTAISQRLYKEGFKVIVGCSANSGRKDDWMATQLAAGYQFECVETDITDWESTRKA
FEMVREHFGPIDVLVNNAGITRDASFRKLTPEDWNAVIGTNLNSLFNTSKQVIEGMLSKG
WGRIINISSINGQRGQFGQTNYSAAKAGIHGFTMALAREVSGKGVTVNTVSPGYIQTDMT
AAIRKDILDGMIAGIPVGRLGQPEEIASIVAWLASDESAYSTGADFSVNGGMNMQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory