SitesBLAST
Comparing AO353_01420 FitnessBrowser__pseudo3_N2E3:AO353_01420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 91% coverage: 58:760/771 of query aligns to 16:719/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M80), G39 (= G81), Q40 (= Q82), H41 (≠ G83), V42 (= V84), A45 (≠ S87), G79 (≠ D121), G80 (= G122), S81 (= S123), S83 (= S125), V84 (≠ M126), G374 (= G416), F375 (= F417), L379 (≠ S421), L499 (≠ Y532), R500 (= R533), V624 (≠ I662), D625 (≠ N663), Q632 (= Q670), T687 (≠ G728), G688 (= G729), L689 (≠ V730), G690 (= G731), E691 (= E732)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 53% coverage: 215:621/771 of query aligns to 15:417/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 552:923/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 511:887/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
26% identity, 48% coverage: 214:583/771 of query aligns to 495:854/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
O54754 Aldehyde oxidase 1; Azaheterocycle hydroxylase 1; Retinal oxidase; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
24% identity, 48% coverage: 214:583/771 of query aligns to 586:964/1333 of O54754
- V806 (≠ S421) mutation to E: Decreases substrate affinity and activity on benzaldehyde, phthalazine and acetaldehyde, while increases affinity for more hydrophobic aldehydes like retinal. Abolishes catalytic activity; when associated with R-884.
- M884 (≠ L502) mutation to R: Abolishes catalytic activity on phthalazine and acetaldehyde. Decreases catalytic efficiency on benzaldehyde and retinal. Abolishes catalytic activity; when associated with E-806.
Sites not aligning to the query:
- 1265 E→Q: Abolishes catalytic activity.
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 39% coverage: 221:517/771 of query aligns to 560:868/1295 of 6a7xA
Sites not aligning to the query:
- active site: 885, 1233, 1234
- binding bicarbonate ion: 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 887, 982, 983, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 39% coverage: 221:517/771 of query aligns to 587:895/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 39% coverage: 221:517/771 of query aligns to 560:868/1291 of 2e3tA
- active site: Q740 (= Q386), E775 (≠ S421), R853 (≠ L502), H857 (≠ F506)
- binding bicarbonate ion: R812 (≠ F456), H813 (= H457), I850 (≠ A499)
- binding calcium ion: E713 (≠ A361), H714 (≠ Q362), Y716 (≠ P364), T809 (≠ S454), G810 (vs. gap), G840 (= G493), T843 (≠ H496), E844 (= E497), S847 (vs. gap)
- binding fe2/s2 (inorganic) cluster: L717 (≠ M365)
- binding uric acid: E775 (≠ S421), R853 (≠ L502)
Sites not aligning to the query:
- active site: 885, 1233, 1234
- binding bicarbonate ion: 882, 883, 887, 888, 891
- binding calcium ion: 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 887, 982, 983, 1051, 1052, 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
25% identity, 39% coverage: 221:517/771 of query aligns to 558:866/1286 of 4yswA
Sites not aligning to the query:
- active site: 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 882, 885, 886, 889
- binding calcium ion: 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 885, 980, 981, 1050, 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 39% coverage: 221:517/771 of query aligns to 558:866/1291 of 6a7xB
Sites not aligning to the query:
- active site: 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 885, 980, 981, 1049, 1050, 1232
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
24% identity, 58% coverage: 221:668/771 of query aligns to 541:995/1262 of 3zyvB
Sites not aligning to the query:
- active site: 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
- binding fe2/s2 (inorganic) cluster: 39, 41, 42, 44, 46, 49, 69, 71, 111, 112, 114, 146, 148
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
24% identity, 58% coverage: 221:668/771 of query aligns to 594:1053/1335 of G3X982
- A802 (≠ G416) binding
- A807 (vs. gap) mutation to V: No effect on kinetic constants with smaller substrates like benzaldehyde or phthalazine. Decreases substrate affinity and slightly increases catalytic efficiency for bulkier substrates like phenanthridine.
- Y885 (≠ L502) mutation to M: Slightly decreases substrate affinity but no effect on activity with smaller substrates like benzaldehyde or phthalazine. Increases catalytic efficiency with bulkier substrates like phenanthridine or more charged substrates like N1-methylnicotinamide.
- K889 (≠ F506) mutation to H: No effect on substrate affinity but decreases catalytic efficiency for smaller substrates like benzaldehyde or phthalazine. Increases substrate affinity and activity for bulkier substrates like phenanthridine.
- L1043 (≠ C658) binding
Sites not aligning to the query:
- 47 binding
- 52 binding
- 55 binding
- 77 binding
- 116 binding
- 117 binding
- 120 binding
- 152 binding
- 154 binding
- 264:271 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 1199 binding
- 1266 E→Q: Loss of activity with different N-heterocyclic compounds as substrates. 60% reduction of activity with benzaldehyde.
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/745 of 3sr6C
Sites not aligning to the query:
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/755 of 3nvzC
Sites not aligning to the query:
- active site: 310, 314, 342, 690, 691
- binding 1h-indole-3-carbaldehyde: 303, 306, 310, 344, 439, 440, 441, 444
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/755 of 3nvvC
Sites not aligning to the query:
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/755 of 3ns1C
Sites not aligning to the query:
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/755 of 3etrC
Sites not aligning to the query:
- active site: 310, 314, 342, 690, 691
- binding calcium ion: 269, 270, 307
- binding pteridine-2,4(1H,3H)-dione: 303, 344, 439, 440, 441, 444, 509
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/758 of 3b9jC
Sites not aligning to the query:
- active site: 310, 314, 342, 690, 691
- binding 6-methyl-3,9-dihydro-2H-purin-2-one: 310, 344, 439, 440, 509, 691
- binding calcium ion: 269, 270
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
23% identity, 30% coverage: 221:451/771 of query aligns to 17:263/756 of 3nvyC
Sites not aligning to the query:
- active site: 310, 314, 342, 690, 691
- binding 3,5,7,3',4'-pentahydroxyflavone: 303, 310, 344, 439, 440, 444, 509
Query Sequence
>AO353_01420 FitnessBrowser__pseudo3_N2E3:AO353_01420
MSQLPNDFALSNLSRRGFLKGVSATGALVLAASWGWQDAFAEEKKFGAAGMPNGWIDDPK
VYVSIAADGSVTVVCNRSEMGQGVRTSLSMVVADELDADWAMVKVRQAPGDEVRFGNQDT
DGSRSMRHWYEPMRRCGAAARTMLEQAAADQWKVPVGECRAQLHKVIHQPTGRELGYGAL
AVAAGALAVPARESLRLKQSSEFRYIGKEGTKAIDGADIVNGRAVYGADVHFDGMLFATV
ARPAVYGGKVKSFDASAALKVPGVVKVIQIESRPLPSEFQPLGGVAVIASNTWAAIKGRE
ALKIEWDDGANAGYDSIVYRKELEAAALKPGKVVRSTGNIEEAMNSADSSLEAAYYLPHL
AQSPMEPMVAVARFKDGHCEAWAPSQAPQVTRERIAERLGIPFDKVTVNVTLLGGGFGRK
SKPDFILEAAILAKEFPGKAVRVQWTREDDIHCSYFHTVSAEYLKASLNKDGMPSGWLHR
TVAPSITALFAPGMNHEAAFELGMGFTNMAYAIPNVRLENPDAAAHTRVGWYRSVSNIPH
GFAIQSFVDELAHKAGQDPLKYQIKLLGPDRQIDPRTLSEEWNYGESPERYPIDTARLRG
VLETAAKGAGWGRKLPKGRGLGLAVHYSFVTYVAAVIEVEVKDDGTLIVHKADIAVDCGP
QINPERIRSQFEGACVMGLGNAVLGEISFKDGKVQQDNFHMYEVARMSLAPKEVAVHLVT
PAGNVPLGGVGEPGVPPIAPALCNAIFAATGKRIRSLPVRYQLQGWQQSKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory