SitesBLAST
Comparing AO353_01425 FitnessBrowser__pseudo3_N2E3:AO353_01425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
54% identity, 96% coverage: 4:153/156 of query aligns to 5:153/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G37), C39 (= C38), G40 (= G39), G42 (= G41), C44 (= C43), G45 (= G44), C47 (= C46), C59 (= C58), C97 (= C97), C100 (= C100), Q101 (= Q101), C132 (= C132), C134 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q96), C134 (= C134)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
39% identity, 95% coverage: 1:148/156 of query aligns to 4:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ F36), C41 (= C38), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C135 (= C132), C137 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C137 (= C134)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
39% identity, 96% coverage: 2:151/156 of query aligns to 5:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), D42 (≠ G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C101 (= C97), G102 (= G98), C104 (= C100), C136 (= C132), C138 (= C134)
- binding pterin cytosine dinucleotide: Q100 (= Q96), C138 (= C134)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
39% identity, 92% coverage: 2:144/156 of query aligns to 6:148/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ F36), C42 (= C38), E43 (≠ G39), G45 (= G41), C47 (= C43), G48 (= G44), C50 (= C46), R60 (= R56), C62 (= C58), C101 (= C97), G102 (= G98), C104 (= C100), C136 (= C132), C138 (= C134)
- binding pterin cytosine dinucleotide: Q100 (= Q96), C138 (= C134)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
35% identity, 96% coverage: 2:151/156 of query aligns to 12:160/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C38), S50 (≠ G41), C52 (= C43), G53 (= G44), C55 (= C46), C67 (= C58), C106 (= C97), G107 (= G98), C109 (= C100), C141 (= C132), C143 (= C134)
- binding pterin cytosine dinucleotide: Q105 (= Q96), C143 (= C134)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
38% identity, 94% coverage: 2:147/156 of query aligns to 6:151/157 of Q0QLF3
- C42 (= C38) binding
- C47 (= C43) binding
- C50 (= C46) binding
- C62 (= C58) binding
- C101 (= C97) binding
- C104 (= C100) binding
- C136 (= C132) binding
- C138 (= C134) binding
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
38% identity, 94% coverage: 2:147/156 of query aligns to 6:151/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ M40), G45 (= G41), E46 (≠ L42)
- binding fe2/s2 (inorganic) cluster: E40 (≠ F36), C42 (= C38), S43 (≠ G39), G45 (= G41), C47 (= C43), G48 (= G44), C50 (= C46), C62 (= C58), Q100 (= Q96), C101 (= C97), G102 (= G98), C104 (= C100), C136 (= C132), C138 (= C134)
- binding pterin cytosine dinucleotide: Q100 (= Q96), C138 (= C134)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
35% identity, 98% coverage: 1:153/156 of query aligns to 3:155/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ F36), C40 (= C38), S43 (≠ G41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C99 (= C97), G100 (= G98), C102 (= C100), C134 (= C132), C136 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q96), C136 (= C134)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
35% identity, 98% coverage: 1:153/156 of query aligns to 4:156/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C38), S44 (≠ G41), H45 (≠ L42), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C135 (= C132), C137 (= C134)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
35% identity, 97% coverage: 2:152/156 of query aligns to 63:228/229 of P77165
- C99 (= C38) binding
- C104 (= C43) binding
- G105 (= G44) binding
- C107 (= C46) binding
- C119 (= C58) binding
- C158 (= C97) binding
- C161 (= C100) binding
- C208 (= C132) binding
- C210 (= C134) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
36% identity, 94% coverage: 2:148/156 of query aligns to 12:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G37), C48 (= C38), D49 (≠ G39), G51 (= G41), C53 (= C43), G54 (= G44), C56 (= C46), C68 (= C58), C107 (= C97), G108 (= G98), C110 (= C100), C157 (= C132), C159 (= C134)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
36% identity, 98% coverage: 3:155/156 of query aligns to 5:160/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), G39 (= G37), C40 (= C38), G41 (= G39), G43 (= G41), Q44 (≠ L42), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding pterin cytosine dinucleotide: Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (= G41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), Q99 (= Q96), C100 (= C97), G101 (= G98), C103 (= C100), C137 (= C132), C139 (= C134)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q96), C139 (= C134)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
34% identity, 97% coverage: 4:155/156 of query aligns to 6:160/907 of Q46509
- C40 (= C38) binding
- C45 (= C43) binding
- C48 (= C46) binding
- C60 (= C58) binding
- C100 (= C97) binding
- C103 (= C100) binding
- C137 (= C132) binding
- C139 (= C134) binding
Query Sequence
>AO353_01425 FitnessBrowser__pseudo3_N2E3:AO353_01425
MITLKLNGQDHQLDVTEDMPLLWAIRDVAGYSGTKFGCGMGLCGACTIHIDGAPARSCIT
PIGSVIGQDVSTIDNLHSDPVGQVVQQAWLDTAVAQCGFCQGGQIMSATALLKTNPNPSD
EQIEQAMVGNICRCGTYNRIKTAIRQASTHLQERKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory