SitesBLAST
Comparing AO353_01655 FitnessBrowser__pseudo3_N2E3:AO353_01655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
27% identity, 66% coverage: 143:451/468 of query aligns to 68:386/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D283), P214 (≠ V284), Y215 (= Y285), G216 (≠ A286), E217 (≠ D287), G241 (= G309), T242 (≠ S310), I246 (≠ T314)
- binding (2E)-pent-2-enedioic acid: Y130 (= Y205), N184 (= N254), R376 (= R441)
- binding glutamic acid: L131 (≠ S206), V360 (≠ S425), A364 (= A429), R369 (≠ G434)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (= Y205), N184 (= N254), D212 (= D282), P214 (≠ V284), Y215 (= Y285), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
27% identity, 66% coverage: 143:451/468 of query aligns to 68:386/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ S206), Q135 (≠ K210), A364 (= A429), R369 (≠ G434)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (= Y205), L131 (≠ S206), A132 (≠ N207), N184 (= N254), R376 (= R441)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (= Y205), V179 (≠ N249), N184 (= N254), D212 (= D282), P214 (≠ V284), Y215 (= Y285), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
27% identity, 66% coverage: 143:451/468 of query aligns to 68:386/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y145), Y130 (= Y205), L275 (= L343)
- binding pyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (= Y205), V179 (≠ N249), N184 (= N254), D212 (= D282), P214 (≠ V284), Y215 (= Y285), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
27% identity, 66% coverage: 143:451/468 of query aligns to 68:386/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (= Y205), V179 (≠ N249), N184 (= N254), D212 (= D282), P214 (≠ V284), Y215 (= Y285), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
32% identity, 62% coverage: 143:434/468 of query aligns to 64:351/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G95 (= G179), S96 (≠ A180), Q97 (≠ T181), Y121 (= Y205), N170 (= N254), D198 (= D282), Y201 (= Y285), S231 (= S310), S233 (= S312), K234 (= K313), R241 (= R320)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
32% identity, 62% coverage: 143:434/468 of query aligns to 64:351/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G179), S96 (≠ A180), Q97 (≠ T181), Y121 (= Y205), N170 (= N254), D198 (= D282), A200 (≠ V284), Y201 (= Y285), S231 (= S310), S233 (= S312), K234 (= K313), R241 (= R320)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
32% identity, 62% coverage: 143:434/468 of query aligns to 68:355/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G99 (= G179), S100 (≠ A180), Q101 (≠ T181), Y125 (= Y205), N174 (= N254), D202 (= D282), Y205 (= Y285), S235 (= S310), S237 (= S312), K238 (= K313), R245 (= R320)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
32% identity, 62% coverage: 143:434/468 of query aligns to 68:355/397 of Q72LL6
- Y70 (= Y145) binding
- N174 (= N254) binding ; binding
- R245 (= R320) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- 40 binding
- 368 binding
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
32% identity, 62% coverage: 143:434/468 of query aligns to 60:347/389 of 2z1yA
- binding leucine: Y117 (= Y205)
- binding pyridoxal-5'-phosphate: G91 (= G179), S92 (≠ A180), Q93 (≠ T181), Y117 (= Y205), N166 (= N254), D194 (= D282), Y197 (= Y285), S227 (= S310), S229 (= S312), K230 (= K313), R237 (= R320)
Sites not aligning to the query:
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
26% identity, 64% coverage: 115:412/468 of query aligns to 45:358/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G179), S113 (≠ A180), Q114 (≠ T181), Y138 (= Y205), N194 (= N254), D222 (= D282), P224 (≠ V284), Y225 (= Y285), T252 (≠ S310), S254 (= S312), K255 (= K313), R262 (= R320)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
31% identity, 51% coverage: 167:404/468 of query aligns to 80:329/388 of 8tn3A
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 62:418/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y74 (= Y145), S117 (≠ A180), Q118 (≠ T181), Y142 (= Y205), N202 (= N254), D230 (= D282), P232 (≠ V284), Y233 (= Y285), S260 (= S310), S262 (= S312), K263 (= K313), R270 (= R320), R399 (= R441)
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 62:418/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y74 (= Y145), S75 (= S146), S77 (= S148), S117 (≠ A180), Q118 (≠ T181), Y142 (= Y205), N202 (= N254), D230 (= D282), P232 (≠ V284), Y233 (= Y285), S260 (= S310), S262 (= S312), R270 (= R320), L293 (= L343), R399 (= R441)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 62:418/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y74 (= Y145), S75 (= S146), S77 (= S148), S117 (≠ A180), Q118 (≠ T181), Y142 (= Y205), N202 (= N254), D230 (= D282), P232 (≠ V284), Y233 (= Y285), S260 (= S310), S262 (= S312), R270 (= R320), L293 (= L343), R399 (= R441)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
25% identity, 70% coverage: 133:460/468 of query aligns to 62:418/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: Y74 (= Y145), S75 (= S146), G116 (= G179), S117 (≠ A180), Q118 (≠ T181), Y142 (= Y205), N202 (= N254), D230 (= D282), P232 (≠ V284), S260 (= S310), S262 (= S312), R270 (= R320), R399 (= R441)
Sites not aligning to the query:
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 56:412/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y68 (= Y145), G110 (= G179), S111 (≠ A180), Q112 (≠ T181), Y136 (= Y205), N196 (= N254), D224 (= D282), P226 (≠ V284), Y227 (= Y285), S254 (= S310), S256 (= S312), K257 (= K313), R264 (= R320), R393 (= R441)
Sites not aligning to the query:
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
24% identity, 65% coverage: 144:449/468 of query aligns to 66:382/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G179), S103 (≠ A180), Q104 (≠ T181), Y128 (= Y205), V177 (≠ N249), N182 (= N254), D210 (= D282), P212 (≠ V284), Y213 (= Y285), T240 (≠ S310), S242 (= S312), K243 (= K313), R250 (= R320)
6t8pA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 56:402/409 of 6t8pA
- binding 3,5-bis(fluoranyl)-~{N}-[5-[(2~{R})-2-(3-fluorophenyl)-3-methyl-butyl]-1,3,4-thiadiazol-2-yl]benzenesulfonamide: Y68 (= Y145), S69 (= S146), K87 (≠ T168), L88 (≠ V169), Y136 (= Y205), K234 (≠ G290), R236 (≠ A292), K257 (= K313), E306 (≠ N359), M310 (≠ R363), V313 (= V366), D314 (≠ Q367), L364 (≠ V423), R383 (= R441)
Sites not aligning to the query:
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 45:401/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y57 (= Y145), S100 (≠ A180), Q101 (≠ T181), Y125 (= Y205), N185 (= N254), D213 (= D282), P215 (≠ V284), Y216 (= Y285), S243 (= S310), S245 (= S312), K246 (= K313), R253 (= R320), R382 (= R441)
Sites not aligning to the query:
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
25% identity, 70% coverage: 133:460/468 of query aligns to 49:405/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: Y61 (= Y145), L280 (= L343)
- binding pyridoxal-5'-phosphate: S104 (≠ A180), Q105 (≠ T181), Y129 (= Y205), D217 (= D282), P219 (≠ V284), S247 (= S310), S249 (= S312), R257 (= R320)
Sites not aligning to the query:
Query Sequence
>AO353_01655 FitnessBrowser__pseudo3_N2E3:AO353_01655
MELRIDRQALVPVVQQIVDALAGWIRQSAIEPGTRLPSIRQLARENLLSQSSVIEAYERM
VAQGVLASRHGSGFFVAGPLDATHRCADPSGPTAADANSVGLADDPLGMLPLGRGGLPES
WRESDDLSYAIRQVSRTDMAGLFNYSPSYGLPVLRQQILKRLQQMSITVDENQVLTTTGA
THGLDLIVRTLLKPGDCVVVESPGYSNLFKLLKLHGVRLLEVPRTSRGPDIEVLEALLSA
NNPRALFINSLFHNPTGSSLAPAVAQRILQLAKRHELIIVEDDVYADFQGSAGTRLAAMD
AGQSVVYVGSFSKTLSSSLRVGYVVASAAIIARLADMKMITSLGASRFCESVLSSLLANG
AYRKLVQRQRQRLKRDMAATLLVLEDAGWEVFGKPAGGLYIWARPREHESAWVRTLAHSF
GIVLSSRTAFSPSGETIDWLRINVAYASDPRAQAFFQACALPDRLRPF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory