SitesBLAST
Comparing AO353_01660 FitnessBrowser__pseudo3_N2E3:AO353_01660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
82% identity, 98% coverage: 5:253/253 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (= L39), C61 (= C63), D62 (≠ N64), V63 (= V65), N89 (= N91), A90 (= A92), T140 (= T142), S142 (= S144), Y155 (= Y157), K159 (= K161), A186 (= A188), V187 (= V189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
45% identity, 98% coverage: 5:252/253 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G18), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), A61 (≠ C63), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), M140 (≠ T142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), Y187 (≠ V189), I188 (= I190), L192 (≠ M194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
41% identity, 100% coverage: 1:252/253 of query aligns to 1:254/255 of 5itvA
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ L39), T61 (≠ C63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I186 (≠ V189), I187 (= I190)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
43% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V215), R211 (≠ G216), R212 (= R217)
- binding bicarbonate ion: I92 (= I94), G94 (≠ I96), R109 (≠ A111), R179 (= R181), S228 (= S233)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), I188 (= I190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
43% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfA
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I94), S93 (≠ E95), G94 (≠ I96), E95 (= E97), T97 (≠ G99), E101 (= E103), T103 (= T105), Q106 (≠ E108), R109 (≠ A111), S175 (≠ K177), G177 (≠ K179)
- binding magnesium ion: S237 (≠ H242), Y238 (≠ S243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), W41 (≠ G43), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
43% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4ureB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A17), G16 (= G18), I17 (= I19), N89 (= N91), G91 (= G93), Y155 (= Y157), P185 (= P187), A186 (= A188)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 100% coverage: 1:252/253 of query aligns to 4:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S144), Q154 (≠ M154), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ A17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ L39), V61 (≠ C63), D62 (≠ N64), V63 (= V65), N89 (= N91), T141 (= T142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ V189), V190 (≠ I190)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
42% identity, 100% coverage: 1:252/253 of query aligns to 1:226/227 of 5itvD
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ L39), T61 (≠ C63), D62 (≠ N64), I63 (≠ V65), N89 (= N91), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I187 (= I190)
4qecA Elxo with NADP bound (see paper)
35% identity, 94% coverage: 11:249/253 of query aligns to 6:244/248 of 4qecA
- active site: G13 (= G18), N111 (= N116), S139 (= S144), Y152 (= Y157), K156 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ A17), G13 (= G18), I14 (= I19), S33 (≠ D38), R34 (≠ L39), K38 (≠ G43), D59 (≠ N64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I137 (≠ T142), Y152 (= Y157), K156 (= K161), P182 (= P187), I185 (= I190)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
44% identity, 98% coverage: 5:252/253 of query aligns to 11:256/257 of 5h5xC
- active site: G24 (= G18), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (≠ A17), G24 (= G18), I25 (= I19), D44 (= D38), F45 (≠ L39), L69 (≠ C63), D70 (≠ N64), N97 (= N91), A98 (= A92), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (≠ A188), I197 (= I190), T199 (= T192)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
41% identity, 96% coverage: 8:250/253 of query aligns to 8:242/244 of 4nbuB
- active site: G18 (= G18), N111 (= N116), S139 (= S144), Q149 (≠ M154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ K98), K98 (≠ E103), S139 (= S144), N146 (≠ A151), V147 (≠ P152), Q149 (≠ M154), Y152 (= Y157), F184 (≠ V189), M189 (= M194), K200 (≠ F208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ L39), V59 (≠ C63), D60 (≠ N64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (= I94), T137 (= T142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ V189), T185 (≠ I190), T187 (= T192), M189 (= M194)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 98% coverage: 2:250/253 of query aligns to 3:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (≠ A17), G19 (= G18), I20 (= I19), D39 (= D38), R40 (≠ L39), C63 (= C63), I65 (≠ V65), N91 (= N91), G93 (= G93), I94 (= I94), V114 (= V115), Y155 (= Y157), K159 (= K161), I188 (= I190), T190 (= T192), T193 (≠ F195)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 11:265/267 of Q9LBG2
- 17:42 (vs. 11:36, 54% identical) binding
- E103 (= E95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 2:256/258 of 1iy8A
- active site: G15 (= G18), S143 (= S144), Q153 (≠ M154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ A17), G15 (= G18), L16 (≠ I19), D35 (= D38), V36 (≠ L39), A62 (≠ C63), D63 (≠ N64), V64 (= V65), N90 (= N91), G92 (= G93), I93 (= I94), T141 (= T142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (≠ A188), T191 (= T192), P192 (≠ D193), M193 (= M194)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
41% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
41% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dteA
- active site: G18 (= G18), S132 (= S144), Y145 (= Y157), S148 (= S160), K149 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S16 (≠ A16), M17 (≠ A17), G18 (= G18), I19 (= I19), S38 (≠ D40), I39 (≠ V41), C52 (= C63), D53 (≠ N64), V54 (= V65), N80 (= N91), A81 (= A92), I130 (≠ T142), S132 (= S144), Y145 (= Y157), K149 (= K161), P174 (= P187), A175 (= A188), T176 (≠ V189), I177 (= I190), T179 (= T192), P180 (≠ D193), L181 (≠ M194), V182 (≠ F195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 3:250/253 of query aligns to 1:245/247 of 4jroC
- active site: G16 (= G18), S142 (= S144), Q152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (≠ A17), G16 (= G18), I17 (= I19), N35 (≠ A37), Y36 (vs. gap), N37 (≠ D38), G38 (≠ L39), S39 (≠ D40), N63 (= N64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (= I94), I113 (≠ V115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
41% identity, 97% coverage: 8:253/253 of query aligns to 3:250/250 of 2cfcA
- active site: G13 (= G18), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ A151), R152 (≠ M154), Y155 (= Y157), W195 (≠ R197), R196 (≠ A198)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (≠ A17), G13 (= G18), N14 (≠ I19), D33 (= D38), L34 (= L39), A59 (≠ C63), D60 (≠ N64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I140 (≠ T142), P185 (= P187), G186 (≠ A188), M187 (≠ V189), I188 (= I190), T190 (= T192), P191 (≠ D193), M192 (= M194), T193 (≠ F195)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
41% identity, 97% coverage: 8:253/253 of query aligns to 3:250/250 of Q56840
- SGN 12:14 (≠ AGI 17:19) binding
- D33 (= D38) binding
- DV 60:61 (≠ NV 64:65) binding
- N87 (= N91) binding
- S142 (= S144) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ M154) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y157) mutation Y->E,F: Loss of activity.
- K159 (= K161) mutation to A: Loss of activity.
- R179 (= R181) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IDTDM 190:194) binding
- WR 195:196 (≠ RA 197:198) binding
- R196 (≠ A198) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ A206) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ M212) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7krmC Putative fabg bound to nadh from acinetobacter baumannii
38% identity, 98% coverage: 3:250/253 of query aligns to 1:241/244 of 7krmC
- active site: G18 (= G18), S140 (= S144), Y155 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), L39 (= L39), A60 (≠ C63), N61 (= N64), V62 (= V65), N88 (= N91), V111 (= V115), S140 (= S144), Y155 (= Y157), K159 (= K161), I188 (= I190), T190 (= T192)
Query Sequence
>AO353_01660 FitnessBrowser__pseudo3_N2E3:AO353_01660
MSMTFSGQVALVTGAAAGIGRATAQAFAAEGLKVVVADLDVAGGEGTAELIRAAGGEAVF
VQCNVTQESDVQNLMAKAVSTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGV
WLCMKYQLPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPKKADFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHSLAVDGGVTAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory