Comparing AO353_02015 FitnessBrowser__pseudo3_N2E3:AO353_02015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
34% identity, 54% coverage: 75:186/209 of query aligns to 74:188/190 of 5u2kA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 72% coverage: 38:188/209 of query aligns to 40:191/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 72% coverage: 38:188/209 of query aligns to 40:191/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 72% coverage: 38:188/209 of query aligns to 40:191/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 72% coverage: 38:188/209 of query aligns to 41:192/203 of P07464
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
39% identity, 51% coverage: 74:179/209 of query aligns to 95:183/188 of 3igjC
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
34% identity, 53% coverage: 75:185/209 of query aligns to 54:165/208 of 2xatA
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
32% identity, 66% coverage: 43:179/209 of query aligns to 46:181/186 of 4isxA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 50% coverage: 76:179/209 of query aligns to 75:181/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 50% coverage: 76:179/209 of query aligns to 72:178/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
33% identity, 50% coverage: 76:179/209 of query aligns to 65:171/176 of 3ectA
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
38% identity, 50% coverage: 76:180/209 of query aligns to 47:141/290 of 4mzuB
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
26% identity, 61% coverage: 73:199/209 of query aligns to 187:295/307 of A1ADJ6
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
38% identity, 50% coverage: 76:180/209 of query aligns to 47:142/294 of 4mzuF
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
45% identity, 32% coverage: 121:186/209 of query aligns to 102:166/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
45% identity, 32% coverage: 121:186/209 of query aligns to 105:169/210 of 6pubA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
30% identity, 73% coverage: 47:199/209 of query aligns to 104:253/258 of 4h7oA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
44% identity, 27% coverage: 129:185/209 of query aligns to 113:169/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
44% identity, 27% coverage: 129:185/209 of query aligns to 113:169/211 of 4hurA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
44% identity, 27% coverage: 129:185/209 of query aligns to 113:169/206 of 6x3jA
Sites not aligning to the query:
>AO353_02015 FitnessBrowser__pseudo3_N2E3:AO353_02015
MVGKLKVRLKQALLKSSTYYVLAAAKYFIANNVIAKMPIESVRKAYYRRIMGLSIGNDTH
LSMRIFLTGYHSRCQVAIGNNCVINRDIYLDGRAGVHIGNNVNVSFQACLLSLHHDHNDP
GFSAIGAPVVVQDHAWIGARAMILPGVTVGEGAVVAAGAVVTRSVPDYAVVGGVPARVIG
QRNRDLTYVTDFAPFFDTDIFDESHAKSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory