Comparing AO353_03010 AO353_03010 succinylglutamate-semialdehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
81% identity, 100% coverage: 1:485/487 of query aligns to 2:486/486 of 3ju8A
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
61% identity, 100% coverage: 3:487/487 of query aligns to 5:488/488 of 5u0mA
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
61% identity, 100% coverage: 3:487/487 of query aligns to 5:488/488 of 5u0lA
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
34% identity, 94% coverage: 6:462/487 of query aligns to 14:471/481 of 3jz4A
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 94% coverage: 6:462/487 of query aligns to 15:472/482 of P25526
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
31% identity, 84% coverage: 3:410/487 of query aligns to 4:415/494 of 5izdA
Sites not aligning to the query:
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
31% identity, 94% coverage: 5:462/487 of query aligns to 13:476/487 of Q9H2A2
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
32% identity, 93% coverage: 2:453/487 of query aligns to 6:462/489 of 4cazA
Sites not aligning to the query:
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 6:462/489 of 2woxA
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 6:462/489 of 2wmeA
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
32% identity, 93% coverage: 2:453/487 of query aligns to 7:463/490 of Q9HTJ1
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8vqwC
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8uznA
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8uzmA
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
33% identity, 92% coverage: 4:453/487 of query aligns to 7:461/488 of 8uzkA
>AO353_03010 AO353_03010 succinylglutamate-semialdehyde dehydrogenase
MNSLYIAGEWLAGQGDMFESLNPVTQQVLWSGQGASAAQVESAVQAARQAFPAWAKRSLE
DRIGVLETFAASLKKHADELAHCIGEETGKPLWEAATEVTSMVNKIAISVQSYRERTGEK
SGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSVLFKPSELTPKVAEL
TVKCWIEAGLPAGVLNLLQGARETGIALAANPGIDGLFFTGSSRTGNHLHAQFSGRPDKI
LALEMGGNNPLVVDQVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWGDTLLARLV
AVSATIDVGAFDQQPAPFMGSVVSLAAAKALMDAQEHLLANGAVPLLKMTQPQANAALLT
PGILDVSAVTDRPDEELFGPLLQVIRYADFEAAIAEANNTQYGLAAGLLSDSEARYQQFW
LESRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCAYPVASLETPSLTLPAA
LTPGVRM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory