SitesBLAST
Comparing AO353_03260 FitnessBrowser__pseudo3_N2E3:AO353_03260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
35% identity, 94% coverage: 5:236/247 of query aligns to 4:229/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (≠ H76), S110 (= S112), N111 (≠ A113), H112 (≠ Q114), Y135 (= Y137), S164 (≠ A166), R173 (= R179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Q13 (≠ R14), L14 (≠ I15), D33 (≠ R34), L34 (≠ V35), D50 (= D51), L51 (= L52), L70 (= L71), G71 (≠ A72), G72 (= G73), S74 (≠ H76), A108 (= A110), S110 (= S112), Y135 (= Y137), K139 (= K141), I162 (= I164), S164 (≠ A166), C165 (≠ F167)
Sites not aligning to the query:
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
35% identity, 94% coverage: 5:236/247 of query aligns to 3:228/265 of Q7CRQ0
- Y134 (= Y137) mutation to A: 0.1% of wild-type activity.
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
35% identity, 94% coverage: 5:236/247 of query aligns to 4:229/265 of 3rfxA
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
30% identity, 64% coverage: 6:163/247 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S112), Y133 (= Y137), K137 (= K141)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), R11 (= R14), V12 (≠ I15), D31 (≠ R34), L32 (≠ V35), S45 (≠ D51), L46 (= L52), L65 (= L71), A67 (≠ G73), V82 (≠ N87), Y133 (= Y137), K137 (= K141)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
30% identity, 64% coverage: 6:163/247 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S112), Y132 (= Y137), K136 (= K141)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), R10 (= R14), V11 (≠ I15), D30 (≠ R34), L31 (≠ V35), R32 (≠ E36), S44 (≠ D51), L45 (= L52), L64 (= L71), A66 (≠ G73), V81 (≠ N87), S106 (= S112), Y132 (= Y137), K136 (= K141)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
33% identity, 64% coverage: 5:163/247 of query aligns to 2:169/307 of 6wjaA
- active site: A118 (≠ S112), A119 (= A113), A120 (≠ Q114), F143 (≠ Y137), K147 (= K141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D31 (= D33), D32 (≠ R34), S34 (≠ E36), T35 (≠ P37), G36 (= G38), A55 (vs. gap), L74 (= L71), A75 (= A72), A76 (≠ G73), S93 (≠ N87), F143 (≠ Y137), K147 (= K141)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ A77), A120 (≠ Q114)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 170, 171, 173
- binding uridine-diphosphate-n-acetylgalactosamine: 172, 186, 187, 191, 202, 204, 211, 247, 270, 273
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
33% identity, 64% coverage: 5:163/247 of query aligns to 3:170/308 of 6wj9B
- active site: A119 (≠ S112), A120 (= A113), A121 (≠ Q114), F144 (≠ Y137), K148 (= K141)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (≠ R14), I13 (= I15), D32 (= D33), D33 (≠ R34), S35 (≠ E36), T36 (≠ P37), G37 (= G38), D55 (vs. gap), A56 (vs. gap), L75 (= L71), A76 (= A72), A77 (≠ G73), S94 (≠ N87), A117 (= A110), A119 (≠ S112), F144 (≠ Y137), K148 (= K141)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ A77)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 171, 172, 174
- binding uridine-diphosphate-n-acetylglucosamine: 173, 187, 188, 192, 203, 204, 205, 212, 248, 271, 274
7eprB Partial consensus l-threonine 3-dehydrogenase (c-change) (see paper)
30% identity, 64% coverage: 5:163/247 of query aligns to 3:166/310 of 7eprB
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Q12 (≠ R14), I13 (= I15), D34 (= D33), I35 (≠ R34), R36 (≠ V35), D50 (= D51), A51 (≠ L52), L72 (= L71), A73 (= A72), A74 (≠ G73), L90 (≠ I89), P113 (≠ S111), Y140 (= Y137), K144 (= K141)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
31% identity, 59% coverage: 6:151/247 of query aligns to 2:149/290 of 3eheA
- active site: T111 (≠ S112), S112 (≠ A113), T113 (= T115), Y135 (= Y137), K139 (= K141)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (≠ R14), I11 (= I15), D29 (= D33), N30 (≠ R34), L31 (≠ V35), S32 (≠ E36), S33 (≠ P37), G34 (= G38), D49 (= D51), L50 (= L52), I68 (≠ L71), A69 (= A72), A70 (≠ G73), T109 (≠ A110), Y135 (= Y137), K139 (= K141)
Sites not aligning to the query:
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
29% identity, 65% coverage: 4:163/247 of query aligns to 3:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), C11 (= C12), G12 (= G13), Q13 (≠ R14), I14 (= I15), D35 (= D33), I36 (≠ R34), L49 (= L50), V51 (≠ L52), L72 (= L71), A73 (= A72), L76 (≠ P75), P113 (≠ S111), S115 (≠ A113), Y140 (= Y137), K144 (= K141)
Sites not aligning to the query:
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
30% identity, 59% coverage: 3:147/247 of query aligns to 1:157/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ R14), I13 (= I15), D32 (= D33), N33 (≠ R34), S35 (≠ E36), G37 (= G38), D57 (= D51), L58 (= L52), F79 (≠ L71), A80 (= A72), I83 (≠ P75), N98 (= N87), Y147 (= Y137), K151 (= K141)
Sites not aligning to the query:
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
34% identity, 41% coverage: 47:148/247 of query aligns to 58:163/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: D62 (= D51), L63 (= L52), F84 (≠ L71), A85 (= A72), G86 (= G73), K88 (≠ P75), N103 (= N87), S126 (≠ A110), S128 (= S112), Y152 (= Y137), K156 (= K141)
- binding uridine-5'-diphosphate-glucose: S128 (= S112), A129 (= A113)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 8, 11, 12, 13, 32, 33, 36, 180, 183
- binding uridine-5'-diphosphate-glucose: 181, 182, 202, 203, 219, 220, 221, 234, 236, 275, 298, 301
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
34% identity, 41% coverage: 47:148/247 of query aligns to 58:163/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: D62 (= D51), L63 (= L52), F84 (≠ L71), A85 (= A72), G86 (= G73), K88 (≠ P75), N103 (= N87), S126 (≠ A110), S128 (= S112), Y152 (= Y137), K156 (= K141)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 8, 11, 12, 13, 32, 33, 36, 180, 183
- binding uridine-diphosphate-n-acetylglucosamine: 182, 202, 203, 219, 221, 234, 236, 275, 298, 301
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 64% coverage: 6:163/247 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S112), Y137 (= Y137), K141 (= K141)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D33), I33 (≠ R34), L46 (= L50), D47 (= D51), V48 (≠ L52), L69 (= L71), A70 (= A72), G71 (= G73), L73 (≠ P75), P110 (≠ A110), S111 (= S111), T112 (≠ S112), Y137 (= Y137), K141 (= K141)
- binding pyruvic acid: S74 (≠ H76), Y137 (= Y137)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 64% coverage: 6:163/247 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S112), Y137 (= Y137), K141 (= K141)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D33), I33 (≠ R34), L46 (= L50), D47 (= D51), L69 (= L71), A70 (= A72), G71 (= G73), L73 (≠ P75), S111 (= S111), Y137 (= Y137), K141 (= K141)
Sites not aligning to the query:
7epsA Partial consensus l-threonine 3-dehydrogenase (e-change) (see paper)
29% identity, 64% coverage: 5:163/247 of query aligns to 2:165/310 of 7epsA
- binding nicotinamide-adenine-dinucleotide: N9 (≠ C12), G10 (= G13), Q11 (≠ R14), I12 (= I15), D33 (= D33), V34 (≠ R34), L48 (= L50), A50 (≠ L52), L71 (= L71), A72 (= A72), A73 (≠ G73), L89 (≠ I89), P112 (≠ A110), Y139 (= Y137), K143 (= K141)
- binding threonine: S76 (≠ H76), S114 (= S112), Y139 (= Y137)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
28% identity, 65% coverage: 4:163/247 of query aligns to 1:157/304 of 3aw9A
- active site: A105 (= A110), S107 (= S112), S108 (≠ A113), T109 (= T115), Y131 (= Y137), K135 (= K141)
- binding galactose-uridine-5'-diphosphate: P69 (= P75), V71 (≠ A77), S107 (= S112), Y131 (= Y137)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D31 (= D33), I32 (≠ R34), R46 (≠ L50), D47 (= D51), L48 (= L52), F65 (≠ L71), A66 (= A72), A67 (≠ G73), E82 (= E83), A105 (= A110), S106 (= S111), Y131 (= Y137), K135 (= K141)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 160, 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 158, 160, 161, 168
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
25% identity, 66% coverage: 4:167/247 of query aligns to 17:190/364 of 2c59A
- active site: S132 (= S112), A133 (= A113), C134 (vs. gap), Y163 (= Y137), K167 (= K141)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (vs. gap), G92 (vs. gap), G93 (= G73), M94 (≠ I74), S132 (= S112), C134 (vs. gap)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (vs. gap), M94 (≠ I74), I97 (≠ A77), S132 (= S112), C134 (vs. gap), Y163 (= Y137)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (≠ R14), I28 (= I15), D47 (≠ R34), W48 (≠ V35), K49 (≠ E36), D67 (= D51), L68 (= L52), L87 (= L71), A89 (vs. gap), M91 (vs. gap), I111 (≠ A91), A130 (= A110), S132 (= S112), Y163 (= Y137), K167 (= K141), F190 (= F167)
Sites not aligning to the query:
- active site: 206
- binding guanosine-5'-diphosphate-beta-l-galactose: 191, 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 345
- binding guanosine-5'-diphosphate-alpha-d-mannose: 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 295, 345
- binding nicotinamide-adenine-dinucleotide: 192, 193, 206
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 64% coverage: 6:163/247 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D33), I33 (≠ R34), L46 (= L50), D47 (= D51), V48 (≠ L52), L69 (= L71), A70 (= A72), G71 (= G73), L73 (≠ P75), P110 (≠ A110), S111 (= S111), T112 (≠ S112), F137 (≠ Y137), K141 (= K141)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ H76), T112 (≠ S112), I113 (≠ A113), F137 (≠ Y137)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 64% coverage: 6:163/247 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D33), I33 (≠ R34), L46 (= L50), D47 (= D51), V48 (≠ L52), L69 (= L71), A70 (= A72), L73 (≠ P75), V87 (vs. gap), P110 (≠ A110), S111 (= S111), K141 (= K141)
- binding threonine: S74 (≠ H76), T112 (≠ S112), F137 (≠ Y137)
Sites not aligning to the query:
Query Sequence
>AO353_03260 FitnessBrowser__pseudo3_N2E3:AO353_03260
MNGLKVLLTGACGRIGKTFFEASKDRYTFTLTDRVEPGFTVNAPHRFFCLDLSDAAAVSA
ALEGIDVIVHLAGIPHATASFDELLPNNILATTYLFEASVAAGCKRLVFASSAQTIEGYP
VDRQITPGMPVMPANLYGVSKCYGEALCAFYSAKRGLSTIALRIGAFEFPDRHELTNARD
LSAWLSPRDAVQLLQRSVEVEGVQYLIGHGISNNRFKRLDLSETTRVLGYEPVDDAFQLF
DIPIAPL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory