Comparing AO353_03810 FitnessBrowser__pseudo3_N2E3:AO353_03810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 80% coverage: 88:439/439 of query aligns to 63:434/446 of A0A0H2VG78
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9
Sites not aligning to the query:
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
19% identity, 79% coverage: 92:439/439 of query aligns to 100:478/512 of Q6PXP3
8fvzA Pipt y150a
25% identity, 45% coverage: 24:219/439 of query aligns to 2:200/433 of 8fvzA
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 53% coverage: 3:235/439 of query aligns to 18:265/572 of O42885
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 35% coverage: 92:244/439 of query aligns to 93:230/580 of Q9C757
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
22% identity, 49% coverage: 21:234/439 of query aligns to 37:231/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 41% coverage: 82:260/439 of query aligns to 117:317/587 of P25297
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 70% coverage: 72:379/439 of query aligns to 55:342/403 of P77589
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
28% identity, 41% coverage: 82:262/439 of query aligns to 66:245/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
28% identity, 41% coverage: 82:262/439 of query aligns to 66:245/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
28% identity, 41% coverage: 82:262/439 of query aligns to 66:245/475 of 4gbyA
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
28% identity, 41% coverage: 82:262/439 of query aligns to 70:249/491 of P0AGF4
Sites not aligning to the query:
P14142 Solute carrier family 2, facilitated glucose transporter member 4; GT2; Glucose transporter type 4, insulin-responsive; GLUT-4 from Mus musculus (Mouse) (see paper)
23% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14142
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
26% identity, 24% coverage: 58:163/439 of query aligns to 177:276/727 of Q496J9
Sites not aligning to the query:
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
28% identity, 38% coverage: 245:412/439 of query aligns to 45:213/504 of A2SWM2
>AO353_03810 FitnessBrowser__pseudo3_N2E3:AO353_03810
MDNSQTLPLGSAAVPAKEKTTASRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKG
DTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGY
ETIGVGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIA
LGVLIVLQQTLTTEQLYDWGWRIPFAIGALCAIVALYLRRGMEETESFAKKEKSKESAMR
TLLRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PIIGGLSDKVGRRPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LLVYVTMKDTRKHSRIETD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory