Comparing AO353_04190 FitnessBrowser__pseudo3_N2E3:AO353_04190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
58% identity, 92% coverage: 38:506/512 of query aligns to 27:496/501 of 2qcuB
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
58% identity, 91% coverage: 38:505/512 of query aligns to 27:495/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
58% identity, 91% coverage: 38:505/512 of query aligns to 27:495/495 of 2r45A
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 94% coverage: 16:496/512 of query aligns to 75:584/629 of Q9SS48
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
34% identity, 66% coverage: 37:376/512 of query aligns to 39:386/530 of 2rgoB
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
30% identity, 88% coverage: 37:486/512 of query aligns to 41:509/557 of 2rgoA
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
28% identity, 89% coverage: 32:487/512 of query aligns to 36:448/496 of 3da1A
Sites not aligning to the query:
>AO353_04190 FitnessBrowser__pseudo3_N2E3:AO353_04190
MPTSTLPMPPLAEVYDIAVIGGGINGVGIAADAAGRGLSVFLCEKDDLASHTSSASSKLI
HGGLRYLEHYEFRLVREALAEREVLLAKAPHIVKPMRFVLPHRPHLRPAWMIRAGLFLYD
HLGKREKLAGSKSLKFGADSALKSEITKGFEYSDCWVDDARLVVLNAMAAREKGAHVHTQ
TRCVSARRSKGLWELNLERTDGRLFSIRAKALVNAAGPWVAKFIRDDLKMESPYGIRLIQ
GSHLIVPKLYEGEHAHILQNEDQRIVFTIPYLNQFTLIGTTDREYTGDPAKVTITEGETD
YLLKVVNAHFKKQISRSDILHTYSGVRPLCNDESDNPSAVTRDYTLALSGSAEEAPLLSV
FGGKLTTYRKLAESAMAQLAPYFKGMKPSWTAQATLPGGEDMTTPQALSALIRDKFDWLP
TEIARRWATTYGSRTWRLLEGVQSLKDMGEHLGGGLYTREVDYLCSEEWATSAHDILWRR
SKLGLFTTQAEQENVQLYLNKLEQNRSKIEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory