Comparing AO353_04255 FitnessBrowser__pseudo3_N2E3:AO353_04255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7fdzA Levansucrase from brenneria sp. Enid 312 with sucrose (see paper)
80% identity, 97% coverage: 12:426/426 of query aligns to 6:416/417 of 7fdzA
4d47A X-ray structure of the levansucrase from erwinia amylovora (see paper)
72% identity, 97% coverage: 13:425/426 of query aligns to 3:411/411 of 4d47A
7osoA The crystal structure of erwinia tasmaniensis levansucrase in complex with (s)-1,2,4-butanentriol (see paper)
72% identity, 97% coverage: 13:426/426 of query aligns to 3:412/412 of 7osoA
8i2rA Beijerinckia indica beta-fructosyltransferase variant h395r/f473y in complex with fructose (see paper)
39% identity, 94% coverage: 18:418/426 of query aligns to 22:472/477 of 8i2rA
Sites not aligning to the query:
3vssA Microbacterium saccharophilum k-1 beta-fructofuranosidase catalytic domain complexed with fructose (see paper)
40% identity, 93% coverage: 18:415/426 of query aligns to 26:472/494 of 3vssA
Sites not aligning to the query:
Q43998 Levansucrase; Beta-D-fructofuranosyl transferase; Sucrose 6-fructosyl transferase; EC 2.4.1.10 from Gluconacetobacter diazotrophicus (Acetobacter diazotrophicus) (see 2 papers)
38% identity, 92% coverage: 18:408/426 of query aligns to 88:524/584 of Q43998
Sites not aligning to the query:
7bj4A Inulosucrase from halalkalicoccus jeotgali bound to kestose (see paper)
38% identity, 94% coverage: 18:418/426 of query aligns to 5:396/406 of 7bj4A
3om2A Crystal structure of b. Megaterium levansucrase mutant d257a (see paper)
28% identity, 95% coverage: 6:411/426 of query aligns to 16:438/448 of 3om2A
1pt2A Crystal structure of levansucrase (e342a) complexed with sucrose (see paper)
27% identity, 85% coverage: 51:411/426 of query aligns to 51:428/440 of 1pt2A
3byjA Crystal structure of b. Subtilis levansucrase mutant d86a
27% identity, 85% coverage: 51:411/426 of query aligns to 51:428/440 of 3byjA
Q74K42 Inulosucrase; IS; EC 2.4.1.9 from Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) (see paper)
24% identity, 77% coverage: 48:373/426 of query aligns to 267:620/797 of Q74K42
Sites not aligning to the query:
2yfrA Crystal structure of inulosucrase from lactobacillus johnsonii ncc533 (see paper)
24% identity, 77% coverage: 48:373/426 of query aligns to 92:445/533 of 2yfrA
Sites not aligning to the query:
2yfsA Crystal structure of inulosucrase from lactobacillus johnsonii ncc533 in complex with sucrose (see paper)
24% identity, 77% coverage: 48:373/426 of query aligns to 92:445/533 of 2yfsA
Sites not aligning to the query:
>AO353_04255 FitnessBrowser__pseudo3_N2E3:AO353_04255
MKSNTEKLGQLPHQPSLWTRADALKVHADDPTTTQPLVSADFPVLSNEVFIWDTMPLRDI
DGNVASVDGWSVIFTLTADRHPNDPEYIDENGNYDIIRDWNDRHGRAKMYYWFSRTGKDW
QFGGRVMAQGVSPTTREWAGSPILLNDQGDVDLYYTAVTPGATIVKVRGRVVTTEHGVEM
VGFKKVTSLFEADGEIYQTETQNPYWGFRDPWPFRDPKDGKLYMLFEGNVAGERGSHKVG
EAEIGDVPPGYEDVGNSRFQTACVGIAVANDEDGDDWEMLPPLLTAVGVNDQTERPHFLF
QDGKYYLFTISHKFTYADGVTGPDGVYGFVADSLFGPYVPLNGSGLVLGNPSSQPFQTYS
HYVMPNGLVTSFIDTVPTKESDTGMQYRVGGTEAPTVGIKVKGQQTFVVAEYDYGYIPPM
IDVTLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory