Comparing AO353_04355 FitnessBrowser__pseudo3_N2E3:AO353_04355 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
57% identity, 100% coverage: 1:434/434 of query aligns to 1:434/435 of Q5F8J4
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
40% identity, 98% coverage: 2:425/434 of query aligns to 3:422/431 of 6dzsA
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
38% identity, 77% coverage: 1:336/434 of query aligns to 2:324/402 of 4pg7A
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
37% identity, 72% coverage: 4:316/434 of query aligns to 4:306/331 of 6a0sA
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
37% identity, 72% coverage: 4:316/434 of query aligns to 4:306/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
37% identity, 72% coverage: 4:316/434 of query aligns to 4:306/332 of 6a0tB
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
34% identity, 72% coverage: 4:317/434 of query aligns to 1:297/300 of 7f4cA
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
34% identity, 72% coverage: 4:317/434 of query aligns to 1:299/302 of 5x9dA
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
29% identity, 68% coverage: 17:313/434 of query aligns to 46:309/319 of 4xb2A
Sites not aligning to the query:
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
29% identity, 68% coverage: 17:313/434 of query aligns to 46:309/319 of 4xb1A
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
38% identity, 32% coverage: 90:226/434 of query aligns to 106:239/321 of 3jsaA
Sites not aligning to the query:
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
32% identity, 32% coverage: 87:226/434 of query aligns to 98:236/319 of 3ingA
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 28% coverage: 90:211/434 of query aligns to 104:231/359 of P31116
Sites not aligning to the query:
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
33% identity, 28% coverage: 90:211/434 of query aligns to 103:230/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
33% identity, 28% coverage: 90:211/434 of query aligns to 103:230/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
33% identity, 28% coverage: 90:211/434 of query aligns to 103:230/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
33% identity, 28% coverage: 90:211/434 of query aligns to 103:230/358 of 1ebfA
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 26% coverage: 97:211/434 of query aligns to 117:239/376 of O94671
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 51% coverage: 92:313/434 of query aligns to 662:906/916 of O81852
Sites not aligning to the query:
3uplA Crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. (see paper)
28% identity, 29% coverage: 2:128/434 of query aligns to 21:164/437 of 3uplA
Sites not aligning to the query:
>AO353_04355 FitnessBrowser__pseudo3_N2E3:AO353_04355
VKPVKVGICGLGTVGGGTFNVLQRNAEEIARRAGRGIEVAQIAMRTPKPQFQTTGIAITN
DVFEVATNPEIDIVIELMGGYTVARELVLKAIENGKHVVTANKALIAVHGNEIFAKAREK
GVIVAFEAAVAGGIPVIKAIREGLSANRINWVAGIINGTGNFILTEMREKGRTFEDVLAE
AQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITKLTTADVNYAEAL
GYRIKHLGVARSTAAGIELRVHPTLIPADRLIANVNGVMNAVMVNGDAAGSTLFYGAGAG
MEPTASSVIADLVDVVRAMTSDPENRVPHLAFQPDSLSAHPILPIEACESAYYLRIQAKD
HPGVLAQVASILSQRGINIESIMQKEVEEHDGLVPMILLTHRVQEQRMNDAIAALEALAD
VVGPVVRIRVEHLN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory