SitesBLAST
Comparing AO353_04405 FitnessBrowser__pseudo3_N2E3:AO353_04405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 63% coverage: 35:311/438 of query aligns to 56:315/444 of Q8NLB7
- D57 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R89) mutation to A: Loss of transport activity.
- W309 (= W305) mutation to V: Loss of transport activity.
- D312 (= D308) mutation to A: Loss of transport activity.
- R313 (= R309) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
25% identity, 73% coverage: 79:399/438 of query aligns to 162:487/554 of O15245
- S189 (≠ C106) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A145) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P165) mutation to F: Decreased TEA uptake.
- P283 (= P200) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (vs. gap) to G: in dbSNP:rs4646278
- P341 (≠ M249) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ L250) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ F269) mutation to F: Decreased TEA uptake.
- Y376 (≠ F285) mutation to F: Decreased TEA uptake.
- G401 (= G311) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ I318) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (= M330) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (= M353) to I: in dbSNP:rs35956182
- V461 (= V372) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G376) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 160 L → F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 82% coverage: 78:437/438 of query aligns to 57:433/446 of A0A0H2VG78
- R102 (= R131) mutation to A: Loss of transport activity.
- I105 (≠ Q134) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E151) mutation to A: Loss of transport activity.
- Q137 (= Q166) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (vs. gap) mutation to A: Loss of transport activity.
- W357 (≠ G361) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
24% identity, 81% coverage: 78:430/438 of query aligns to 160:516/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G139), W216 (= W142), Q240 (= Q166), W353 (≠ L262), Y360 (≠ F269), F378 (≠ E283), S381 (≠ L286), E385 (≠ C290), C449 (≠ G361), S469 (= S378)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
24% identity, 81% coverage: 78:430/438 of query aligns to 160:516/532 of 8et7A
Sites not aligning to the query:
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
30% identity, 28% coverage: 78:200/438 of query aligns to 162:284/555 of Q9R0W2
Sites not aligning to the query:
- 451 Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; C→M: Transport activity strongly reduced.
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
30% identity, 28% coverage: 79:200/438 of query aligns to 144:265/453 of 8sc2A
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 34% coverage: 78:227/438 of query aligns to 98:254/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
32% identity, 23% coverage: 79:179/438 of query aligns to 144:236/445 of 8sc3A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
32% identity, 23% coverage: 79:179/438 of query aligns to 144:236/447 of 8sc6A
Sites not aligning to the query:
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
29% identity, 38% coverage: 78:244/438 of query aligns to 143:302/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
31% identity, 28% coverage: 78:200/438 of query aligns to 160:282/517 of 8et9A
Sites not aligning to the query:
Query Sequence
>AO353_04405 FitnessBrowser__pseudo3_N2E3:AO353_04405
MTTSTTYSDAVPAQPTNSTTRVATASFIGTAIEFYDFYVYATAAALVIGPVFFPQTSGTA
QMLSAFLTFGIAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVLPGYESIG
AWAPILLCVLRFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGFLAANGLF
LTLAMTLNDEQFRSWGWRIPFLLSAVLVMVGLYVRLKLHETPVFANAMARQERVKIPLVE
LFSQYWAPMLLGAAAMVVCYALFYISTVFSLSYGVSTLGYSRETFLGLLCFAVLFMAAAT
PLSAWASDRFGRKPVLIIGGVLAILSGFTMEPLLTHGTTWGVALFLCIELFLMGVTFAPM
GALLPELFPTRVRYTGASAAYNLGGIVGASAAPFFAQKLVAMGGLSWVGGYVSAAAVISL
IAVLCLKETRHNDLNQVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory