Comparing AO353_04425 FitnessBrowser__pseudo3_N2E3:AO353_04425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n27A X-ray structure of brucella abortus rica (see paper)
57% identity, 89% coverage: 15:169/174 of query aligns to 18:172/175 of 4n27A
7zw9A Crystal structure of a gamma-carbonic anhydrase from the pathogenic bacterium burkholderia pseudomallei (see paper)
51% identity, 97% coverage: 3:171/174 of query aligns to 4:172/173 of 7zw9A
2fkoA Structure of ph1591 from pyrococcus horikoshii ot3 (see paper)
52% identity, 95% coverage: 3:167/174 of query aligns to 4:168/173 of 2fkoA
1v3wA Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3 (see paper)
52% identity, 95% coverage: 3:167/174 of query aligns to 4:168/173 of 1v3wA
6iveA Molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase (see paper)
43% identity, 96% coverage: 3:169/174 of query aligns to 3:163/168 of 6iveA
Q5KW03 Carbonic anhydrase; Gamma-carbonic anhydrase; Cag; EC 4.2.1.1 from Geobacillus kaustophilus (strain HTA426) (see paper)
41% identity, 86% coverage: 16:165/174 of query aligns to 16:165/182 of Q5KW03
3vnpA Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
41% identity, 86% coverage: 16:165/174 of query aligns to 17:166/171 of 3vnpA
8e73G2 qcr9 (see paper)
37% identity, 86% coverage: 17:166/174 of query aligns to 59:209/258 of 8e73G2
3tioF Crystal structures of yrda from escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations (see paper)
39% identity, 83% coverage: 21:165/174 of query aligns to 22:173/177 of 3tioF
3r3rA Structure of the yrda ferripyochelin binding protein from salmonella enterica
38% identity, 88% coverage: 21:173/174 of query aligns to 27:182/184 of 3r3rA
8gpmA Acinetobacter baumannii carbonic anhydrase
43% identity, 91% coverage: 14:171/174 of query aligns to 15:172/193 of 8gpmA
8gppA Acinetobacter baumannii carbonic anhydrase paay
43% identity, 91% coverage: 14:171/174 of query aligns to 14:171/189 of 8gppA
7a23p Plant mitochondrial respiratory complex i (see paper)
35% identity, 87% coverage: 15:166/174 of query aligns to 53:210/224 of 7a23p
Sites not aligning to the query:
7aqqz Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
35% identity, 87% coverage: 15:166/174 of query aligns to 57:214/233 of 7aqqz
Sites not aligning to the query:
7ar7y Cryo-em structure of arabidopsis thaliana complex-i (open conformation) (see paper)
36% identity, 87% coverage: 17:168/174 of query aligns to 59:216/268 of 7ar7y
Sites not aligning to the query:
7aqqy Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
36% identity, 87% coverage: 17:168/174 of query aligns to 59:216/268 of 7aqqy
8bpxy Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (see paper)
36% identity, 87% coverage: 17:168/174 of query aligns to 60:217/265 of 8bpxy
Sites not aligning to the query:
8befy Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) (see paper)
36% identity, 87% coverage: 17:168/174 of query aligns to 60:217/265 of 8befy
Sites not aligning to the query:
6sc4B Gamma-carbonic anhydrase from the haloarchaeon halobacterium sp. (see paper)
32% identity, 97% coverage: 1:169/174 of query aligns to 2:178/178 of 6sc4B
3ixcA Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
36% identity, 86% coverage: 16:165/174 of query aligns to 19:165/166 of 3ixcA
>AO353_04425 FitnessBrowser__pseudo3_N2E3:AO353_04425
MKYRLGDARVETHPQSWVAPNAVLVGKVKLEEGANVWFNAVLRGDNELILIGKNSNVQDG
TVMHTDMGYPLTIGTGVTIGHNAMLHGCTVGDYSLIGINAVILNGAKIGKNCIIGANSLI
GEGKEIPDGSLVMGSPGKVVRELTEPQKKMLEASAAHYVHNSQRYARDLVEQEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory