SitesBLAST
Comparing AO353_05015 FitnessBrowser__pseudo3_N2E3:AO353_05015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
74% identity, 99% coverage: 1:316/320 of query aligns to 3:319/319 of 5vt3B
- active site: C138 (= C136), C141 (= C139), D142 (= D140)
- binding flavin-adenine dinucleotide: G15 (= G13), S16 (= S14), G17 (= G15), P18 (= P16), A19 (= A17), T38 (= T36), G39 (= G37), Q41 (= Q39), G44 (= G42), Q45 (= Q43), L46 (= L44), T49 (= T47), N54 (= N52), H86 (= H84), I87 (= I85), S114 (≠ A112), T115 (= T113), G116 (= G114), E162 (= E160), H247 (= H244), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L120), G156 (= G154), G157 (= G155), N158 (= N156), T159 (= T157), H178 (= H176), R179 (= R177), R180 (= R178), R184 (= R182), I245 (= I242), G246 (= G243), R295 (= R292), Q296 (= Q293)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
73% identity, 98% coverage: 1:313/320 of query aligns to 4:317/319 of 5u63B
- active site: C139 (= C136), C142 (= C139), D143 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G13), S17 (= S14), G18 (= G15), P19 (= P16), A20 (= A17), T39 (= T36), G40 (= G37), Q42 (= Q39), G45 (= G42), Q46 (= Q43), L47 (= L44), T50 (= T47), N55 (= N52), H87 (= H84), I88 (= I85), A115 (= A112), T116 (= T113), G117 (= G114), H248 (= H244), G288 (= G284), D289 (= D285), R296 (= R292), Q297 (= Q293), A298 (= A294), S301 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R118), G157 (= G154), H179 (= H176), R180 (= R177), R181 (= R178), I246 (= I242), G247 (= G243), H248 (= H244), R296 (= R292)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
70% identity, 100% coverage: 1:319/320 of query aligns to 1:321/321 of P0A9P4
- M1 (= M1) modified: Initiator methionine, Removed
- 36:43 (vs. 36:43, 75% identical) binding
- C136 (= C136) modified: Disulfide link with 139, Redox-active
- C139 (= C139) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 285:294, 80% identical) binding
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
71% identity, 98% coverage: 5:319/320 of query aligns to 4:320/320 of 1f6mA
- active site: S135 (≠ C136), C138 (= C139), D139 (= D140)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L120), G153 (= G154), G154 (= G155), N155 (= N156), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R177 (= R178), R181 (= R182), I243 (= I242), G244 (= G243), H245 (= H244), R293 (= R292), Q294 (= Q293)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H84), I84 (= I85), A111 (= A112), T112 (= T113), G113 (= G114), H245 (= H244), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
71% identity, 97% coverage: 5:315/320 of query aligns to 4:316/316 of 1tdfA
- active site: C135 (= C136), S138 (≠ C139), D139 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H84), I84 (= I85), A111 (= A112), T112 (= T113), S138 (≠ C139), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L120), I151 (≠ V152), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R181 (= R182), E183 (= E184), I243 (= I242), G244 (= G243), H290 (= H289), R293 (= R292)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
58% identity, 96% coverage: 5:312/320 of query aligns to 5:311/315 of 4jnqA
- active site: C137 (= C136), C140 (= C139), D141 (= D140)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L12), G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), A36 (≠ T36), G37 (= G37), Q39 (= Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), N52 (= N52), I85 (= I85), A113 (= A112), T114 (= T113), C140 (= C139), G283 (= G284), D284 (= D285), R291 (= R292), Q292 (= Q293), A293 (= A294)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
52% identity, 95% coverage: 9:312/320 of query aligns to 6:303/306 of 5uthA
- active site: C133 (= C136), C136 (= C139), D137 (= D140)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), F32 (≠ I35), E33 (≠ T36), G34 (= G37), Q36 (= Q39), G39 (= G42), A40 (≠ Q43), L41 (= L44), N49 (= N52), D81 (≠ H84), V82 (≠ I85), M110 (≠ T113), G111 (= G114), C136 (= C139), G275 (= G284), D276 (= D285), R283 (= R292), Q284 (= Q293), A285 (= A294), A288 (≠ S297)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
52% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R118), H115 (≠ Y119), L116 (= L120), R173 (= R177), E200 (≠ T207), I201 (≠ L208), I235 (= I242)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
52% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L120), R173 (= R177), E200 (≠ T207), I201 (≠ L208)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
52% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R118), H115 (≠ Y119), L116 (= L120), V148 (= V152), R173 (= R177), E200 (≠ T207), I201 (≠ L208)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
52% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G154), G151 (= G155), D152 (≠ N156), S153 (≠ T157), E156 (= E160), H172 (= H176), R173 (= R177), R174 (= R178), R178 (= R182), I235 (= I242)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
50% identity, 95% coverage: 9:312/320 of query aligns to 17:315/335 of P9WHH1
- SGPA 22:25 (= SGPA 14:17) binding
- Y32 (= Y24) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 36:43, 38% identical) binding
- N60 (= N52) binding
- V93 (≠ I85) binding
- C145 (= C136) modified: Disulfide link with 148, Redox-active
- C148 (= C139) modified: Disulfide link with 145, Redox-active
- S166 (≠ T157) binding
- H185 (= H176) binding
- R191 (= R182) binding
- I248 (= I242) binding
- Y268 (= Y261) binding
- D288 (= D285) binding
- R295 (= R292) binding
- RQAV 295:298 (≠ RQAI 292:295) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
50% identity, 95% coverage: 9:312/320 of query aligns to 8:306/313 of 2a87A
- active site: F39 (≠ A40), L43 (= L44), D48 (≠ E49), C136 (= C136), C139 (= C139), D140 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ I35), E35 (≠ T36), G36 (= G37), G40 (= G41), G41 (= G42), A42 (≠ Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), D83 (≠ H84), V84 (≠ I85), M113 (≠ T113), C139 (= C139), G278 (= G284), D279 (= D285), R286 (= R292), Q287 (= Q293), A288 (= A294), V289 (≠ I295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L120), G155 (= G155), D156 (≠ N156), S157 (≠ T157), H176 (= H176), R177 (= R177), R178 (= R178), R182 (= R182), I239 (= I242), Y259 (= Y261), R283 (≠ H289), R286 (= R292)
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
47% identity, 97% coverage: 6:316/320 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: I8 (≠ L12), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ I35), G33 (= G37), A36 (= A40), I39 (vs. gap), G43 (= G42), Q44 (= Q43), I51 (≠ V50), N53 (= N52), T85 (≠ H84), V86 (≠ I85), T118 (= T113), G119 (= G114), C144 (= C139), G286 (= G284), D287 (= D285), R294 (= R292), Q295 (= Q293), A296 (= A294), S299 (= S297)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L120), G160 (= G153), S164 (≠ T157), R184 (= R177), K185 (≠ R178), R189 (= R182), I247 (= I242)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
47% identity, 97% coverage: 6:316/320 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C136), C145 (= C139), D146 (= D140)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), Y32 (≠ I35), E33 (≠ T36), G34 (= G37), A37 (= A40), I40 (vs. gap), A41 (vs. gap), G44 (= G42), Q45 (= Q43), T49 (= T47), I52 (≠ V50), N54 (= N52), T86 (≠ H84), V87 (≠ I85), T119 (= T113), G120 (= G114), W135 (≠ M129), C145 (= C139), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
47% identity, 97% coverage: 6:316/320 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 14:17) binding
- IA 40:41 (vs. gap) binding
- Q45 (= Q43) binding
- N54 (= N52) binding
- V87 (≠ I85) binding
- C142 (= C136) modified: Disulfide link with 145, Redox-active
- C145 (= C139) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D285) binding
- RQA 295:297 (= RQA 292:294) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
47% identity, 95% coverage: 9:312/320 of query aligns to 72:377/515 of Q70G58
- C203 (= C136) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C139) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A158) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H176) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R177) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
45% identity, 98% coverage: 6:317/320 of query aligns to 2:324/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ I35), E32 (≠ T36), G33 (= G37), A36 (vs. gap), T38 (vs. gap), A39 (≠ Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), T47 (= T47), I50 (≠ V50), N52 (= N52), T84 (≠ H84), I85 (= I85), T120 (= T113), G121 (= G114), C146 (= C139), G291 (= G284), D292 (= D285), R299 (= R292), Q300 (= Q293), A301 (= A294), S304 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G154), G164 (= G155), S166 (≠ T157), R186 (= R177), R187 (= R178), R191 (= R182), V252 (≠ I242)
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
47% identity, 95% coverage: 9:312/320 of query aligns to 4:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G13), S9 (= S14), G10 (= G15), P11 (= P16), A12 (= A17), E31 (≠ T36), G32 (= G37), N35 (vs. gap), G36 (vs. gap), G39 (= G42), Q40 (= Q43), L41 (= L44), T44 (= T47), N49 (= N52), D81 (≠ H84), V82 (≠ I85), A109 (= A112), T110 (= T113), W126 (≠ M129), S136 (≠ C139), G276 (= G284), D277 (= D285), R284 (= R292), Q285 (= Q293), A286 (= A294), A289 (≠ S297)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
45% identity, 98% coverage: 1:314/320 of query aligns to 12:332/356 of 5w4cA
- binding calcium ion: E99 (≠ D83), E116 (≠ D100), E118 (≠ A102)
- binding flavin-adenine dinucleotide: I23 (≠ L12), G24 (= G13), S25 (= S14), P27 (= P16), G28 (≠ A17), Y46 (≠ I35), G48 (= G37), A51 (= A40), F54 (vs. gap), G58 (= G42), Q59 (= Q43), L60 (= L44), T63 (= T47), N68 (= N52), V101 (≠ I85), T134 (= T113), G135 (= G114), G302 (= G284), D303 (= D285), R310 (= R292), Q311 (= Q293), A312 (= A294), S315 (= S297)
Sites not aligning to the query:
Query Sequence
>AO353_05015 FitnessBrowser__pseudo3_N2E3:AO353_05015
MSDVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGL
TGPALMDRMKEHAERFETEIVFDHINAVDFASKPYTLTGDSATYTCDALIIATGASARYL
GLPSEETFMGKGVSACATCDGFFYRNREVAVVGGGNTAVEEALYLANIASKVTLIHRRET
FRAEKILIDKLHARVAEGKIVLKLNSTLDEVLGDNMGVTGARLKNNDGSFDELKVDGVFI
AIGHTPNTSLFEGQLTLKDGYLVVQGGREGNATATSLEGIFAAGDVADHVYRQAITSAGA
GCMAALDAERYLDDLQNAKF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory