SitesBLAST
Comparing AO353_05480 FitnessBrowser__pseudo3_N2E3:AO353_05480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
30% identity, 97% coverage: 4:307/313 of query aligns to 10:315/318 of 2jg1A
- active site: G259 (= G251), S260 (≠ A252), G261 (= G253), D262 (= D254)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K40), N193 (= N186), S230 (= S222), G232 (= G224), G235 (= G227), I252 (≠ V244), V254 (= V246), G259 (= G251), S260 (≠ A252), G261 (= G253), D262 (= D254), T264 (≠ L256), N286 (≠ T278), G289 (≠ A281), M290 (≠ A282)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
30% identity, 97% coverage: 4:307/313 of query aligns to 7:312/315 of 2jg1C
- active site: G256 (= G251), S257 (≠ A252), G258 (= G253), D259 (= D254)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S222), G229 (= G224), A230 (= A225), G232 (= G227), I246 (≠ P241), I249 (≠ V244), V251 (= V246), V255 (= V250), G256 (= G251), S257 (≠ A252), G258 (= G253), D259 (= D254), T261 (≠ L256), N283 (≠ T278), G286 (≠ A281), M287 (≠ A282)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (= K40), R93 (= R90), C95 (≠ N92), L108 (≠ N106), G140 (= G138), S141 (= S139), D259 (= D254)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
30% identity, 97% coverage: 4:307/313 of query aligns to 6:311/314 of 2jgvB
- active site: G255 (= G251), S256 (≠ A252), G257 (= G253), D258 (= D254)
- binding adenosine-5'-diphosphate: S226 (= S222), A229 (= A225), I248 (≠ V244), P253 (≠ T249), S256 (≠ A252), G257 (= G253), N282 (≠ T278), G285 (≠ A281), M286 (≠ A282)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
34% identity, 91% coverage: 4:287/313 of query aligns to 3:288/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (= N186), S224 (= S222), G226 (= G224), I243 (≠ P241), I246 (≠ V244), G253 (= G251), S254 (≠ A252), G255 (= G253), T258 (≠ L256), M280 (≠ A279), G283 (≠ A282), M284 (= M283)
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
29% identity, 97% coverage: 4:307/313 of query aligns to 3:305/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N186), S220 (= S222), G222 (= G224), A223 (= A225), G225 (= G227), V242 (= V244), G249 (= G251), A250 (= A252), G251 (= G253), D252 (= D254), S279 (≠ A281), V283 (= V285)
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
31% identity, 96% coverage: 1:300/313 of query aligns to 1:290/307 of 3uqeA
- active site: G253 (= G251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding adenosine-5'-triphosphate: K185 (= K184), N187 (= N186), S224 (= S222), G226 (= G224), P227 (≠ A225), G229 (= G227), S248 (≠ V246), A254 (= A252), G255 (= G253), M258 (≠ L256), V280 (≠ F290), G283 (= G293), S284 (≠ D294), T287 (≠ Q297)
- binding pyrophosphate 2-: N187 (= N186), K189 (≠ E188)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
31% identity, 96% coverage: 1:300/313 of query aligns to 1:290/309 of 3uqdB
- active site: G253 (= G251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding adenosine-5'-diphosphate: K185 (= K184), N187 (= N186), S224 (= S222), G226 (= G224), P227 (≠ A225), G229 (= G227), S248 (≠ V246), M258 (≠ L256), V280 (≠ F290), G283 (= G293), S284 (≠ D294)
- binding adenosine-5'-triphosphate: Y23 (≠ E23), K27 (≠ V27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (≠ D104), S139 (= S139), G253 (= G251)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
31% identity, 96% coverage: 1:300/313 of query aligns to 1:290/309 of 3uqdA
- active site: G253 (= G251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding adenosine-5'-triphosphate: K185 (= K184), S224 (= S222), G226 (= G224), P227 (≠ A225), G229 (= G227), T251 (= T249), G255 (= G253), M258 (≠ L256), V280 (≠ F290), G283 (= G293), S284 (≠ D294), T287 (≠ Q297)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (≠ A38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S139), D256 (= D254)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
31% identity, 96% coverage: 1:300/313 of query aligns to 1:290/309 of 3n1cA
- active site: G253 (= G251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (≠ V27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G138), S139 (= S139), D256 (= D254)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 96% coverage: 1:300/313 of query aligns to 1:290/309 of P06999
- K27 (≠ V27) binding ; binding
- KPN 185:187 (= KPN 184:186) binding in other chain
- NQK 187:189 (≠ NTE 186:188) binding in other chain
- E190 (= E189) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SHGAEG 222:227) binding in other chain
- S248 (≠ V246) binding in other chain
- S250 (= S248) binding
- V252 (= V250) binding
- V280 (≠ F290) binding in other chain
- S284 (≠ D294) binding in other chain
- A286 (= A296) binding
- N289 (≠ A299) binding
Sites not aligning to the query:
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
31% identity, 91% coverage: 1:284/313 of query aligns to 1:286/304 of 3cqdA
- active site: G253 (= G251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding adenosine-5'-triphosphate: Y23 (≠ E23), G26 (≠ Q26), K27 (≠ V27), K185 (= K184), N187 (= N186), N187 (= N186), K189 (≠ E188), S224 (= S222), G226 (= G224), P227 (≠ A225), G229 (= G227), S248 (≠ V246), T251 (= T249), A254 (= A252), G255 (= G253), M258 (≠ L256), V280 (≠ T278), G283 (≠ A281), S284 (≠ A282)
Sites not aligning to the query:
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
30% identity, 91% coverage: 4:287/313 of query aligns to 3:278/298 of 3julA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 84% coverage: 3:264/313 of query aligns to 13:275/339 of P9WID3
Sites not aligning to the query:
- 283 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
28% identity, 84% coverage: 4:266/313 of query aligns to 3:274/320 of 2ajrA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
24% identity, 80% coverage: 39:289/313 of query aligns to 31:292/319 of Q8ZKR2
- G31 (= G39) binding
- Y101 (≠ D104) binding
- R162 (vs. gap) binding
- A180 (vs. gap) binding
- A181 (vs. gap) binding
- A183 (vs. gap) binding
- G213 (= G215) binding
- D246 (≠ S248) binding
- T248 (≠ V250) binding
- D252 (= D254) binding
- A287 (= A284) binding
- A290 (≠ Q287) binding
- G292 (= G289) binding
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 83% coverage: 23:282/313 of query aligns to 18:279/300 of 1v1bA
- active site: G248 (= G251), A249 (= A252), G250 (= G253), D251 (= D254)
- binding adenosine-5'-triphosphate: K219 (≠ S222), G221 (= G224), A238 (≠ P241), F239 (≠ P242), V241 (= V244), G248 (= G251), A249 (= A252), G250 (= G253), N275 (≠ T278), A279 (= A282)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 83% coverage: 23:282/313 of query aligns to 18:279/309 of Q53W83
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 83% coverage: 23:282/313 of query aligns to 18:279/301 of 1v1aA
- active site: G248 (= G251), A249 (= A252), G250 (= G253), D251 (= D254)
- binding adenosine-5'-diphosphate: K219 (≠ S222), G221 (= G224), A222 (= A225), A249 (= A252), G250 (= G253), N275 (≠ T278), A279 (= A282)
- binding 2-keto-3-deoxygluconate: G34 (= G39), A35 (≠ K40), N38 (= N43), Y89 (≠ N92), R105 (≠ N106), R167 (= R173), G248 (= G251), D251 (= D254)
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
24% identity, 80% coverage: 39:289/313 of query aligns to 27:281/299 of 1tz3A
- active site: F88 (≠ I102), G238 (= G251), A239 (= A252), G240 (= G253), D241 (= D254)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), L83 (≠ K94), F88 (≠ I102), Y90 (≠ D104), R151 (vs. gap), M154 (vs. gap), D241 (= D254)
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
28% identity, 88% coverage: 13:289/313 of query aligns to 10:283/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ L165), T217 (≠ S222), G219 (= G224), A220 (= A225), G222 (= G227), F250 (≠ L256), N272 (≠ T278), G275 (≠ A281), A276 (= A282), T279 (≠ V285)
- binding magnesium ion: D242 (≠ S248), T244 (≠ V250), A278 (= A284)
Sites not aligning to the query:
Query Sequence
>AO353_05480 FitnessBrowser__pseudo3_N2E3:AO353_05480
MAKILTLTLNPALDLTVQLPHLEPGQVNRSDAMHTHAAGKGINVAQVLADLGHQLTVSGF
LGEDNLQAFEALFAKRGFVDAFIRVPGETRSNIKLAEADGRITDINGPGPVVSAAAQQAL
LDRLDQITLGHDAVVVAGSLPRGVSAQWLHGLLLRLKSRGLKVALDTSGEALRAGLSAGP
WLIKPNTEELSEALDCEAISVAAQAEAASRLHAHGIEHVVISHGAEGVNWFSVGSAMHAT
PPRVSVVSTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIGDAAQLAQ
LEQEVRVRLLTEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory