SitesBLAST
Comparing AO353_05685 FitnessBrowser__pseudo3_N2E3:AO353_05685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S25), A19 (= A26), G21 (= G28), L22 (= L29), G23 (= G30), Y101 (= Y112), F223 (= F232), T224 (≠ S233), S226 (= S235), M229 (≠ V238), L321 (= L330)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/446 of 6yu6B
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
40% identity, 97% coverage: 11:461/467 of query aligns to 4:437/441 of 4us3A
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (≠ S31), T224 (≠ S233), D256 (= D265), A313 (= A322), S316 (= S325), S317 (= S326)
- binding tryptophan: S18 (= S25), A19 (= A26), L22 (= L29), G23 (= G30), Y101 (= Y112), F223 (= F232), T224 (≠ S233), S226 (= S235), M229 (≠ V238), S320 (= S329), L321 (= L330)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
40% identity, 95% coverage: 18:461/467 of query aligns to 2:428/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ I193), T180 (= T200), I287 (≠ V305), R288 (≠ A306), L289 (≠ F307)
- binding sodium ion: G8 (= G24), S9 (= S25), A10 (= A26), V11 (= V27), V11 (= V27), N15 (≠ S31), T215 (≠ S233), D247 (= D265), A304 (= A322), S307 (= S325), S308 (= S326)
- binding tryptophan: S9 (= S25), A10 (= A26), G12 (= G28), G14 (= G30), Y92 (= Y112), F214 (= F232), T215 (≠ S233), S217 (= S235), M220 (≠ V238), L312 (= L330)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:448/501 of 3gwwA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F244 (= F232), T245 (≠ S233), S247 (= S235), F250 (≠ V238), I350 (≠ L330)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L29), G22 (= G30), R26 (≠ K34), Y104 (= Y112), A310 (≠ G290), F311 (≠ P291), D392 (≠ K372), D395 (≠ K375)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:450/502 of 3uslA
- binding selenomethionine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F246 (= F232), T247 (≠ S233), S249 (= S235), S348 (= S326), I352 (≠ L330)
- binding sodium ion: G16 (= G24), N17 (≠ S25), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T247 (≠ S233), N279 (≠ D265), A344 (= A322), T347 (≠ S325), S348 (= S326)
- binding phosphocholine: N83 (≠ H90), R84 (≠ S91), F85 (≠ A92)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:450/502 of 3usgA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), F246 (= F232), T247 (≠ S233), S249 (= S235), F252 (≠ V238)
- binding sodium ion: G16 (= G24), N17 (≠ S25), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T247 (≠ S233), N279 (≠ D265), A344 (= A322), T347 (≠ S325), S348 (= S326)
- binding phosphocholine: N83 (≠ H90), R84 (≠ S91)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:450/504 of 3f3aA
- binding sodium ion: G16 (= G24), N17 (≠ S25), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T247 (≠ S233), N279 (≠ D265), A344 (= A322), T347 (≠ S325), S348 (= S326)
- binding tryptophan: R7 (= R15), A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), R26 (≠ K34), Y104 (= Y112), G242 (= G228), F246 (= F232), F246 (= F232), T247 (≠ S233), S249 (= S235), F252 (≠ V238), D265 (≠ H251), Q266 (≠ S252), D267 (≠ S253), F299 (= F277), N303 (≠ F281), A306 (≠ G284), I307 (≠ L285), A310 (≠ S288), N314 (≠ G292), S348 (= S326), I352 (≠ L330), D397 (≠ K375), G401 (≠ A391), T402 (≠ Q392), G432 (vs. gap)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/498 of 3gwvA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L29), R26 (≠ K34), A313 (≠ G290), F314 (≠ P291), L394 (≠ W371), D395 (≠ K372), D398 (≠ K375)
3uspA Crystal structure of leut in heptyl-beta-d-selenoglucoside (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/503 of 3uspA
- binding heptyl 1-seleno-beta-D-glucopyranoside: K117 (≠ D125), L122 (vs. gap), E153 (≠ P150), I155 (vs. gap), K157 (≠ R152), P158 (≠ L153), F161 (≠ W156), Y163 (≠ T158), H385 (≠ L362), H385 (≠ L362), L386 (≠ G363), F389 (= F366), F389 (= F366), L394 (≠ W371), D395 (≠ K372), D398 (≠ K375), P439 (= P439), Y442 (≠ F442)
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T248 (≠ S233), N280 (≠ D265), A345 (= A322), T348 (≠ S325), S349 (= S326)
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ K34), V29 (≠ Y37), Q30 (≠ M38), I107 (≠ V115), R187 (= R178), F188 (≠ S179), I191 (= I182), A313 (≠ G290), F314 (≠ P291), F344 (≠ I321), D395 (≠ K372)
- binding leucine: A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T248 (≠ S233), N280 (≠ D265), A345 (= A322), T348 (≠ S325), S349 (= S326)
3mpnA F177r1 mutant of leut (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/505 of 3mpnA
- binding leucine: N17 (≠ S25), A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238), S349 (= S326)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (≠ L162), A377 (= A354)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/509 of 3gwuA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W33), R26 (≠ K34), Y104 (= Y112), F247 (= F232), A313 (≠ G290), D395 (≠ K372), D398 (≠ K375)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/509 of 3f4jA
- binding glycine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), G22 (= G30), N23 (≠ S31), T248 (≠ S233), N280 (≠ D265), A345 (= A322), G346 (≠ A323), T348 (≠ S325), S349 (= S326)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/509 of 3f3dA
- binding methionine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), S349 (= S326), I353 (≠ L330)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T248 (≠ S233), N280 (≠ D265), A345 (= A322), T348 (≠ S325), S349 (= S326)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
25% identity, 95% coverage: 12:454/467 of query aligns to 4:451/509 of 3f3cA
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (≠ S31), T248 (≠ S233), N280 (≠ D265), A345 (= A322), T348 (≠ S325), S349 (= S326)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F232), T248 (≠ S233), S250 (= S235), F253 (≠ V238), S349 (= S326), I353 (≠ L330)
Query Sequence
>AO353_05685 FitnessBrowser__pseudo3_N2E3:AO353_05685
MSSDKVSVHGSWASRWVFILAATGSAVGLGSIWKFPYMVGVYGGGAFVLVFLACIALIGV
PVMLAETLIGRRARQSPANALKVLALEAGHSAKWSWGAFAGMITALLILSFYSVVGGWSL
DYIIDMGRGDFQGVTADQVGAYFGGVIADPWRLTLWHTLFMLLSAFVIARGVVAGLERSL
RIMMPLLFVMLVILLGYSLTTGHFMEGVHFMFDFNPDKLLDGLLPAMGHAFFSLSVGVGS
IMIYGAYMPKHSSISGTIVGVALLDTFVSLLAGLALFPIVFAAGLNPSEGPGLMFVSLPF
AFGNVAFGQLMGVVFFVLVAIAAWSSAISLLEPMVAYLVERTNIRRGWVTFWLAFSCWFV
GLGTVFSFNIWKQAKFFVNDGGAFHLYQWGAQNGLDFFGVIDFFTSRIMLPLGGLCFVVF
AGWVMGREAVRDELSMRSPALFALTLFLMRYVAPIGILVVFAAQLWK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory