SitesBLAST
Comparing AO353_05775 FitnessBrowser__pseudo3_N2E3:AO353_05775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 33% coverage: 70:217/446 of query aligns to 203:347/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 33% coverage: 70:217/446 of query aligns to 203:347/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 46% coverage: 28:233/446 of query aligns to 56:245/444 of Q8NLB7
- D57 (= D29) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K81) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
27% identity, 35% coverage: 76:231/446 of query aligns to 63:202/446 of A0A0H2VG78
- R102 (= R123) mutation to A: Loss of transport activity.
- I105 (≠ Q126) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E143) mutation to A: Loss of transport activity.
- Q137 (≠ M158) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Query Sequence
>AO353_05775 FitnessBrowser__pseudo3_N2E3:AO353_05775
VGIQQKNPARQRRRAFIGATSGHLIEWYDYGVYGFLAVYIGKAFFVSDDPTSSLLASFAA
FALSFFIRPLGGLFFGPLADKIGRRKTLITVLVMMAGSTVLLGLLPTYATLGIAAPILLV
LIRCVQGFSAGGEIGTITSFISEYAGPGRRGFATCWLMVTAVLGLLLGGAVANGMTWVMG
ADLMQAWGWRIPFLIAAPLGLISMYIRLKLEDSPEFLALQRAGETSKAPLREVWQWKRAI
ALVFFIITLHSSIFYLVLTFASTYMSSILKFDSGTTLLYVFVASLSAAVVMPFGGAFTDK
YGRKPFLLVVGTLATLAMYWLFKSAPTATPASFIYPLMTVAILFGLYASSTYALMSELLP
TRIRSTGIAVAYNIPVAVFGGSAPLISTWLIKVTGDITSPWYFYIGTGVVSLIALVLLRK
EDFVACASPAEKPNVGRADLALAPTP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory