SitesBLAST
Comparing AO353_06175 FitnessBrowser__pseudo3_N2E3:AO353_06175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jyqA Quinate dehydrogenase from corynebacterium glutamicum in complex with shikimate and nadh (see paper)
51% identity, 98% coverage: 4:282/284 of query aligns to 1:282/282 of 3jyqA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ M134), G135 (= G137), G136 (= G138), V137 (≠ A139), D157 (= D159), L158 (≠ V160), R162 (= R164), T201 (= T201), P202 (= P202), M205 (= M205), V227 (≠ I227), A254 (= A254)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S16 (= S19), N66 (= N69), T68 (= T71), N93 (= N96), D109 (= D111), Q257 (= Q257)
3jypA Quinate dehydrogenase from corynebacterium glutamicum in complex with quinate and nadh (see paper)
51% identity, 98% coverage: 4:282/284 of query aligns to 1:282/282 of 3jypA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ M134), G135 (= G137), V137 (≠ A139), D157 (= D159), L158 (≠ V160), R162 (= R164), T201 (= T201), P202 (= P202), M205 (= M205), A212 (≠ P212), V227 (≠ I227), Y229 (= Y229), A254 (= A254)
- binding (1S,3R,4S,5R)-1,3,4,5-tetrahydroxycyclohexanecarboxylic acid: S16 (= S19), T18 (= T21), N66 (= N69), T68 (= T71), K72 (= K75), N93 (= N96), D109 (= D111), Q257 (= Q257)
3jyoA Quinate dehydrogenase from corynebacterium glutamicum in complex with NAD (see paper)
51% identity, 98% coverage: 4:282/284 of query aligns to 1:282/282 of 3jyoA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ M134), G135 (= G137), V137 (≠ A139), D157 (= D159), L158 (≠ V160), R162 (= R164), T201 (= T201), P202 (= P202), M205 (= M205), V227 (≠ I227), Y229 (= Y229), A254 (= A254)
Q9X5C9 Quinate/shikimate dehydrogenase (NAD(+)); QSDH; EC 1.1.1.-; EC 1.1.1.24 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
51% identity, 98% coverage: 4:282/284 of query aligns to 2:283/283 of Q9X5C9
- S17 (= S19) binding
- SRT 17:19 (= SRT 19:21) binding
- T69 (= T71) binding ; binding
- K73 (= K75) active site, Proton acceptor; binding ; binding
- N94 (= N96) binding ; binding
- D110 (= D111) binding ; binding
- GV 137:138 (≠ GA 138:139) binding
- D158 (= D159) binding
- R163 (= R164) binding
- PMGM 203:206 (= PMGM 202:205) binding
- A213 (≠ P212) binding
- V228 (≠ I227) binding
- G251 (= G250) binding
- Q258 (= Q257) binding ; binding
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
30% identity, 93% coverage: 11:275/284 of query aligns to 5:257/269 of Q5HNV1
- SLS 13:15 (≠ SRT 19:21) binding
- T60 (= T71) binding
- N85 (= N96) binding
- D100 (= D111) binding
- Y211 (= Y229) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q257) binding
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 97% coverage: 1:275/284 of query aligns to 6:277/287 of 1nvtB
- active site: K75 (= K75), D111 (= D111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ F72), G135 (= G135), G137 (= G137), G138 (= G138), A139 (= A139), N157 (≠ D159), R158 (≠ V160), T159 (≠ D161), K162 (≠ R164), A200 (≠ T200), T201 (= T201), P202 (= P202), I203 (≠ M203), M205 (= M205), L229 (≠ I227), Y231 (= Y229), M255 (= M253), L256 (≠ A254)
- binding zinc ion: E22 (≠ Q17), H23 (≠ A18)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 97% coverage: 1:275/284 of query aligns to 6:277/287 of 1nvtA
- active site: K75 (= K75), D111 (= D111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G135), A139 (= A139), N157 (≠ D159), R158 (≠ V160), T159 (≠ D161), K162 (≠ R164), A200 (≠ T200), T201 (= T201), P202 (= P202), I203 (≠ M203), M205 (= M205), L229 (≠ I227), Y231 (= Y229), G252 (= G250), M255 (= M253), L256 (≠ A254)
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 97% coverage: 1:275/284 of query aligns to 1:272/282 of Q58484
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
32% identity, 92% coverage: 5:266/284 of query aligns to 9:274/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ F72), G134 (= G135), A135 (= A136), G136 (= G137), G137 (= G138), A138 (= A139), N158 (vs. gap), R159 (vs. gap), D161 (= D159), F163 (≠ D161), T207 (= T201), V209 (≠ M203), M211 (= M205), F214 (≠ L208), V235 (≠ I227), Y237 (= Y229), M261 (= M253), M262 (≠ A254)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S19), S25 (≠ T21), N68 (= N69), S70 (≠ T71), K74 (= K75), N95 (= N96), D110 (= D111), Q265 (= Q257)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
32% identity, 92% coverage: 5:266/284 of query aligns to 12:277/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G135), A138 (= A136), G139 (= G137), G140 (= G138), A141 (= A139), N161 (vs. gap), R162 (vs. gap), D164 (= D159), F166 (≠ D161), T210 (= T201), G211 (≠ P202), V212 (≠ M203), M214 (= M205), F217 (≠ L208), V238 (≠ I227), Y240 (= Y229), G261 (= G250), M264 (= M253), M265 (≠ A254)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
32% identity, 92% coverage: 5:266/284 of query aligns to 12:277/291 of Q8Y9N5
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
29% identity, 93% coverage: 11:275/284 of query aligns to 5:248/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (= S19), S15 (≠ T21), N58 (= N69), T60 (= T71), K64 (= K75), N85 (= N96), D100 (= D111), F227 (≠ A254), Q230 (= Q257)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
29% identity, 94% coverage: 1:267/284 of query aligns to 1:252/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ F72), G130 (= G135), G133 (= G138), A134 (= A139), N153 (≠ S163), R154 (= R164), T155 (≠ A165), K158 (≠ L168), T188 (= T201), S189 (≠ P202), V190 (≠ M203), I214 (= I227), M238 (= M253), L239 (≠ A254)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S19), S21 (≠ T21), N64 (= N69), T66 (= T71), K70 (= K75), N91 (= N96), D106 (= D111), Y216 (= Y229), L239 (≠ A254), Q242 (= Q257)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
29% identity, 94% coverage: 1:267/284 of query aligns to 1:252/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ F72), G132 (= G137), G133 (= G138), A134 (= A139), N153 (≠ S163), R154 (= R164), T155 (≠ A165), T188 (= T201), S189 (≠ P202), V190 (≠ M203)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S19), S21 (≠ T21), N64 (= N69), K70 (= K75), N91 (= N96), D106 (= D111), Y216 (= Y229), L239 (≠ A254), Q242 (= Q257)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
29% identity, 94% coverage: 1:267/284 of query aligns to 1:252/269 of O67049
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
30% identity, 92% coverage: 8:267/284 of query aligns to 9:272/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A136), G133 (= G137), G134 (= G138), A135 (= A139), N155 (vs. gap), R156 (vs. gap), D158 (= D159), F160 (≠ D161), T204 (= T201), K205 (≠ P202), V206 (≠ M203), M208 (= M205), C232 (≠ I227), M258 (= M253), L259 (≠ A254)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 92% coverage: 8:267/284 of query aligns to 9:272/288 of P0A6D5
- S22 (≠ T21) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (= Y38) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T71) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K75) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N96) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (= T110) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D111) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (= AGGA 136:139) binding
- NRRD 155:158 (≠ ---D 159) binding
- K205 (≠ P202) binding
- CVYN 232:235 (≠ IVYF 227:230) binding
- G255 (= G250) binding
- Q262 (= Q257) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7colA Crystal structure of 5-ketofructose reductase complexed with NADPH (see paper)
36% identity, 87% coverage: 39:284/284 of query aligns to 36:279/280 of 7colA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G128 (= G135), G130 (= G137), G131 (= G138), A132 (= A139), N152 (≠ D159), R153 (≠ V160), K157 (≠ R164), T195 (= T201), S196 (≠ P202), I197 (≠ M203), V222 (≠ I227), Q252 (= Q257)
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
30% identity, 92% coverage: 8:267/284 of query aligns to 3:266/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A136), G127 (= G137), G128 (= G138), A129 (= A139), R150 (vs. gap), F154 (≠ D161), K199 (≠ P202), V200 (≠ M203), M202 (= M205), C226 (≠ I227), Y228 (= Y229), M252 (= M253), L253 (≠ A254)
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
32% identity, 92% coverage: 8:269/284 of query aligns to 9:274/288 of Q8ZPR4
Query Sequence
>AO353_06175 FitnessBrowser__pseudo3_N2E3:AO353_06175
MSQNNTVLAGLIGAGIQASRTPALHEREGDAQGLRYLYRLIDLDQLKLDSGALPDLLMSA
ERMNFTGLNITFPCKQAIIPLLDELSPEARGIGAVNTVVLKDGKRIGHNTDCLGFAEGFR
RGLKDAARERVVQMGAGGAGAAVAHALLSEGVQQLSIFDVDVSRAQSLANNLNQHFGSGR
ACAGSDLPSALAQADGLVNTTPMGMAKLPGMPVPVELLRAELWVAEIVYFPLETELLRNA
RALGCRTLDGGNMAVFQAVKAFELFSGVAPDAQRMLAHFQSMNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory