Comparing AO353_06185 FitnessBrowser__pseudo3_N2E3:AO353_06185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
82% identity, 100% coverage: 1:633/633 of query aligns to 1:635/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
82% identity, 99% coverage: 1:625/633 of query aligns to 3:624/624 of 5hmqD
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
34% identity, 52% coverage: 296:624/633 of query aligns to 9:345/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
35% identity, 52% coverage: 296:624/633 of query aligns to 12:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
35% identity, 52% coverage: 296:624/633 of query aligns to 11:337/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
35% identity, 50% coverage: 296:612/633 of query aligns to 11:313/320 of 7xntC
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 52% coverage: 297:626/633 of query aligns to 5:346/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
31% identity, 52% coverage: 297:626/633 of query aligns to 6:348/357 of O52791
7yvvA Acmp1, r-4-hydroxymandelate synthase
27% identity, 53% coverage: 292:624/633 of query aligns to 1:334/335 of 7yvvA
1t47A Structure of fe2-hppd bound to ntbc (see paper)
27% identity, 46% coverage: 334:624/633 of query aligns to 50:360/362 of 1t47A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
27% identity, 49% coverage: 316:624/633 of query aligns to 24:342/343 of 3zgjB
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
28% identity, 28% coverage: 435:612/633 of query aligns to 177:363/393 of Q02110
Sites not aligning to the query:
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
27% identity, 28% coverage: 436:612/633 of query aligns to 172:357/374 of 8im2A
Sites not aligning to the query:
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
27% identity, 28% coverage: 436:612/633 of query aligns to 172:357/371 of 8im3A
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
27% identity, 28% coverage: 436:612/633 of query aligns to 170:355/376 of 5ec3A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 28% coverage: 436:612/633 of query aligns to 178:363/393 of P32755
Sites not aligning to the query:
1i6nA 1.8 a crystal structure of ioli protein with a binding zinc atom (see paper)
29% identity, 24% coverage: 89:241/633 of query aligns to 94:248/278 of 1i6nA
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 42% coverage: 335:601/633 of query aligns to 107:398/445 of P93836
7x5wA Crystal structure of athppd-y18022 complex
26% identity, 42% coverage: 335:601/633 of query aligns to 73:350/381 of 7x5wA
Sites not aligning to the query:
1sqdA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
27% identity, 42% coverage: 335:601/633 of query aligns to 73:347/373 of 1sqdA
>AO353_06185 FitnessBrowser__pseudo3_N2E3:AO353_06185
MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYDGSPREIKQMCADLGIAITLF
QPFRDFEGCRRDRLPRNLERAERKFDLMQELGTDLVLVCSNASADSVGDEQILVDDLRLL
AERAGARGLRIGYEALAWGQHVNTYQQVWNIVRQADHPNLGVLLDSFHTLSLKGDPRAIA
DIPGEKIFFVQMADAPILAMDVLEWSRHFRCFPGQGEFDLPGFLAPIIQSGYTGPLSLEV
FNDGFRAAPPRANAADGLRSLLYLEEKTRARLQQQATPTPNLDILFATPPASEYDGIEFL
EFAVDESLGAKLSNWLERLGFVKAGEHRSKNVTLLRQGDINLILNSEPYSFAHSFFEAHG
PSLCATAVRVKDSASALARAVAYKGQPYRGLVGPNELELAAVRAPDGSLIYLVDEHADVY
GTDFRLHPTAATAGGLKRIDHMAMALPADSLDSWVLFYKSLLDFEADDEVVLPDPYGLVK
SRALRSRCSSIRLPLNISENRNTAISHALSSYRGSGVHHIAFDCDDMFAEVSRAKEAGVP
LLDIPLNYYDDLAARFDFDDEFLSKLAYYNVLYDRDAQGGELFHVYTEPFEGRFFFEIIQ
RKNGYAGYGAANVAVRLAAMAKSRSGGVRHAKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory