SitesBLAST
Comparing AO353_07420 FitnessBrowser__pseudo3_N2E3:AO353_07420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yb6A L-amino acid oxidase/monooxygenase from pseudomonas sp. Aiu 813 - l- lysine complex (see paper)
92% identity, 99% coverage: 5:560/560 of query aligns to 1:556/556 of 5yb6A
- active site: E241 (= E245), K361 (= K365)
- binding flavin-adenine dinucleotide: V47 (= V51), G48 (= G52), I51 (= I55), A52 (= A56), E71 (= E75), A72 (= A76), G77 (= G81), R78 (= R82), L79 (= L83), G95 (= G99), G96 (= G100), R98 (= R102), F99 (= F103), V297 (= V301), L331 (= L335), I336 (= I340), S359 (= S363), W459 (= W463), F465 (= F469), A468 (= A472), F469 (= F473), G503 (= G507), D504 (= D508), A511 (= A515), W512 (= W516), V513 (= V517), A516 (= A520)
- binding lysine: R98 (= R102), W231 (= W235), D234 (= D238), T333 (= T337), W348 (= W352), D352 (= D356), R390 (= R394), L391 (= L395), Y412 (= Y416), W414 (= W418), A511 (= A515), W512 (= W516)
5yb8A L-amino acid oxidase/monooxygenase from pseudomonas sp. Aiu 813 - l- arginine complex (see paper)
92% identity, 98% coverage: 12:560/560 of query aligns to 1:549/549 of 5yb8A
- active site: E234 (= E245), K354 (= K365)
- binding arginine: R91 (= R102), D227 (= D238), E333 (= E344), Q338 (= Q349), D345 (= D356), D382 (= D393), R383 (= R394), Y405 (= Y416), W407 (= W418), A504 (= A515), W505 (= W516)
- binding flavin-adenine dinucleotide: V40 (= V51), G41 (= G52), G43 (= G54), I44 (= I55), A45 (= A56), E64 (= E75), A65 (= A76), G70 (= G81), R71 (= R82), L72 (= L83), G88 (= G99), G89 (= G100), M90 (= M101), R91 (= R102), F92 (= F103), G289 (= G300), V290 (= V301), C320 (= C331), L324 (= L335), I329 (= I340), W452 (= W463), F458 (= F469), A461 (= A472), F462 (= F473), D497 (= D508), A504 (= A515), W505 (= W516), V506 (= V517)
5yb7A L-amino acid oxidase/monooxygenase from pseudomonas sp. Aiu 813 - l- ornithine complex (see paper)
92% identity, 98% coverage: 12:560/560 of query aligns to 1:549/549 of 5yb7A
- active site: E234 (= E245), K354 (= K365)
- binding flavin-adenine dinucleotide: V40 (= V51), G41 (= G52), G43 (= G54), I44 (= I55), A45 (= A56), E64 (= E75), A65 (= A76), G70 (= G81), R71 (= R82), L72 (= L83), G88 (= G99), G89 (= G100), R91 (= R102), F92 (= F103), V290 (= V301), C320 (= C331), L324 (= L335), I329 (= I340), W452 (= W463), F458 (= F469), A461 (= A472), F462 (= F473), G496 (= G507), D497 (= D508), A504 (= A515), W505 (= W516), V506 (= V517)
- binding L-ornithine: R91 (= R102), D227 (= D238), T326 (= T337), E333 (= E344), Q338 (= Q349), W341 (= W352), D345 (= D356), R383 (= R394), L384 (= L395), Y405 (= Y416), A504 (= A515), W505 (= W516)
P06617 Tryptophan 2-monooxygenase; EC 1.13.12.3 from Pseudomonas savastanoi (Pseudomonas syringae pv. savastanoi) (see paper)
31% identity, 92% coverage: 30:544/560 of query aligns to 23:547/557 of P06617
- K365 (= K365) mutation to M: Abolishes catalytic activity.
- W466 (= W463) mutation to F: Slightly decreases enzyme activity.; mutation to M: Abolishes flavin binding.
4iv9A Structure of the flavoprotein tryptophan-2-monooxygenase (see paper)
31% identity, 92% coverage: 30:544/560 of query aligns to 18:542/552 of 4iv9A
- active site: E249 (= E245), K360 (= K365)
- binding flavin-adenine dinucleotide: G40 (= G52), G42 (= G54), S44 (≠ A56), E64 (= E75), S65 (≠ A76), R66 (vs. gap), G71 (= G81), R72 (= R82), G90 (= G99), A91 (≠ G100), M92 (= M101), R93 (= R102), V295 (= V301), W461 (= W463), A470 (= A472), G505 (= G507), C506 (≠ D508), G513 (≠ A515), W514 (= W516), I515 (≠ V517), A518 (= A520)
- binding 2-(1h-indol-3-yl)acetamide: F239 (≠ W235), M253 (≠ V249), W410 (= W418), F471 (= F473), G513 (≠ A515), W514 (= W516)
G8XQX1 L-amino-acid oxidase; DrLAO; LAAO; EC 1.4.3.2 from Daboia russelii (Russel's viper) (Vipera russelii) (see paper)
24% identity, 93% coverage: 9:527/560 of query aligns to 19:494/504 of G8XQX1
- H241 (vs. gap) mutation to A: Shows high reactivity toward L-Arg, but does not induce change toward L-Leu, L-Phe and L-Met.; mutation to N: No change in activity.; mutation to S: Shows middle reactivity toward L-Arg and L-Phe, but does not induce change toward L-Leu, and L-Met.
Sites not aligning to the query:
3kveA Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
23% identity, 86% coverage: 48:527/560 of query aligns to 34:474/484 of 3kveA
- active site: P90 (= P104), H221 (vs. gap), K324 (= K365)
- binding flavin-adenine dinucleotide: V37 (= V51), G38 (= G52), G40 (= G54), S42 (≠ A56), L60 (≠ Y74), E61 (= E75), A62 (= A76), G68 (= G81), R69 (= R82), G85 (= G99), P86 (≠ G100), M87 (= M101), R88 (= R102), R258 (≠ S288), V259 (≠ L289), T292 (= T329), Y370 (= Y416), W418 (= W463), Y423 (≠ H468), I428 (≠ F473), G454 (= G507), E455 (≠ D508), G462 (≠ A515), W463 (= W516), I464 (≠ V517), T467 (≠ A520)
P0DI84 L-amino-acid oxidase; LAO; VAA-LAAO I; EC 1.4.3.2 from Vipera ammodytes ammodytes (Western sand viper) (see paper)
23% identity, 86% coverage: 48:527/560 of query aligns to 34:474/484 of P0DI84
- MS 41:42 (≠ IA 55:56) binding
- EA 61:62 (= EA 75:76) binding
- R69 (= R82) binding
- H73 (≠ Q86) binding
- GPMR 85:88 (≠ GGMR 99:102) binding
- N170 (≠ R187) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C171 (≠ L188) modified: Disulfide link with 8
- V259 (≠ L289) binding
- E277 (≠ V314) binding
- C329 (≠ V370) modified: Disulfide link with 410
- C410 (≠ I454) modified: Disulfide link with 329
- E455 (≠ D508) binding
- GWIDST 462:467 (≠ AWVEGA 515:520) binding
Sites not aligning to the query:
- 8 modified: Disulfide link with 171
C0HJE7 L-amino acid oxidase bordonein-L; LAAO; LAO; EC 1.4.3.2 from Crotalus durissus terrificus (South American rattlesnake) (see paper)
22% identity, 86% coverage: 48:527/560 of query aligns to 54:494/516 of C0HJE7
- C189 (≠ V196) modified: Disulfide link with 28
- C349 (≠ V370) modified: Disulfide link with 430
- C430 (≠ I455) modified: Disulfide link with 349
Sites not aligning to the query:
- 28 modified: Disulfide link with 189
Q6STF1 L-amino-acid oxidase; AHP-LAAO; LAO; EC 1.4.3.2 from Gloydius halys (Chinese water mocassin) (Agkistrodon halys) (see paper)
22% identity, 87% coverage: 39:527/560 of query aligns to 45:494/504 of Q6STF1
- MS 61:62 (≠ IA 55:56) binding
- EA 81:82 (= EA 75:76) binding
- R89 (= R82) binding
- GPMR 105:108 (≠ GGMR 99:102) binding
- R108 (= R102) binding
- N190 (≠ W192) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C191 (≠ N193) modified: Disulfide link with 28
- H241 (vs. gap) binding
- V279 (≠ R298) binding
- C349 (≠ V370) modified: Disulfide link with 430
- N379 (≠ D406) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- Y390 (= Y416) binding
- C430 (≠ I454) modified: Disulfide link with 349
- E475 (≠ D508) binding
- GWIDST 482:487 (≠ AWVEGA 515:520) binding
Sites not aligning to the query:
- 1:18 signal peptide
- 28 modified: Disulfide link with 191
1tdoA L-amino acid oxidae from agkistrodon halys in complex with l- phenylalanine
22% identity, 87% coverage: 39:527/560 of query aligns to 25:474/484 of 1tdoA
- active site: P90 (= P104), H221 (vs. gap), K324 (= K365)
- binding flavin-adenine dinucleotide: V37 (= V51), G38 (= G52), G40 (= G54), S42 (≠ A56), L60 (≠ Y74), E61 (= E75), A62 (= A76), G68 (= G81), R69 (= R82), G85 (= G99), P86 (≠ G100), M87 (= M101), R88 (= R102), Q258 (≠ P297), V259 (≠ R298), T292 (= T329), Y370 (= Y416), W418 (= W463), Y423 (≠ H468), G427 (≠ A472), I428 (≠ F473), E455 (≠ D508), G462 (≠ A515), W463 (= W516), I464 (≠ V517), T467 (≠ A520)
- binding phenylalanine: R88 (= R102), N206 (≠ F230), H221 (vs. gap), F225 (= F247), Y354 (= Y400), Y370 (= Y416)
1tdnA L-amino acid oxidase from agkistrodon halys in complex with l-leucine
22% identity, 87% coverage: 39:527/560 of query aligns to 25:474/484 of 1tdnA
- active site: P90 (= P104), H221 (vs. gap), K324 (= K365)
- binding flavin-adenine dinucleotide: G38 (= G52), G40 (= G54), S42 (≠ A56), L60 (≠ Y74), E61 (= E75), A62 (= A76), G68 (= G81), R69 (= R82), G85 (= G99), P86 (≠ G100), M87 (= M101), R88 (= R102), Q258 (≠ P297), V259 (≠ R298), T292 (= T329), Y370 (= Y416), Y423 (≠ H468), G427 (≠ A472), I428 (≠ F473), E455 (≠ D508), G462 (≠ A515), W463 (= W516), I464 (≠ V517), T467 (≠ A520)
- binding leucine: R88 (= R102), N206 (≠ F230), F225 (= F247), Y370 (= Y416)
1tdkA L-amino acid oxidase from agkistrodon halys in complex with suicide substrate l-vinylglycine
22% identity, 87% coverage: 39:527/560 of query aligns to 25:474/484 of 1tdkA
- active site: P90 (= P104), H221 (vs. gap), K324 (= K365)
- binding flavin-adenine dinucleotide: V37 (= V51), G38 (= G52), G40 (= G54), S42 (≠ A56), L60 (≠ Y74), E61 (= E75), A62 (= A76), G68 (= G81), R69 (= R82), G85 (= G99), P86 (≠ G100), R88 (= R102), Q258 (≠ P297), V259 (≠ R298), T292 (= T329), G427 (≠ A472), I428 (≠ F473), E455 (≠ D508), G462 (≠ A515), W463 (= W516), I464 (≠ V517), T467 (≠ A520)
- binding l-vinylglycine: R88 (= R102), R88 (= R102), N206 (≠ F230), H221 (vs. gap), Y354 (= Y400), Y370 (= Y416)
1reoA L-amino acid oxidase from agkistrodon halys pallas (see paper)
22% identity, 87% coverage: 39:527/560 of query aligns to 25:474/484 of 1reoA
- active site: P90 (= P104), H221 (vs. gap), K324 (= K365)
- binding flavin-adenine dinucleotide: G38 (= G52), G40 (= G54), S42 (≠ A56), L60 (≠ Y74), E61 (= E75), A62 (= A76), G68 (= G81), R69 (= R82), G85 (= G99), P86 (≠ G100), R88 (= R102), Q258 (≠ P297), V259 (≠ R298), T292 (= T329), Y370 (= Y416), Y423 (≠ H468), G427 (≠ A472), I428 (≠ F473), E455 (≠ D508), G462 (≠ A515), W463 (= W516), I464 (≠ V517), T467 (≠ A520)
Q6TGQ9 L-amino-acid oxidase BjussuLAAO-I; BjsuLAAO; LAO; EC 1.4.3.2 from Bothrops jararacussu (Jararacussu) (see paper)
22% identity, 85% coverage: 48:523/560 of query aligns to 49:485/497 of Q6TGQ9
- C186 (≠ L188) modified: Disulfide link with 23
- C344 (≠ V370) modified: Disulfide link with 425
- C425 (≠ I455) modified: Disulfide link with 344
Sites not aligning to the query:
- 23 modified: Disulfide link with 186
Q96RQ9 L-amino-acid oxidase; LAAO; LAO; Interleukin-4-induced protein 1; IL4-induced protein 1; hIL4I1; Protein Fig-1; hFIG1; EC 1.4.3.2; EC 1.4.3.25 from Homo sapiens (Human) (see 4 papers)
25% identity, 35% coverage: 347:544/560 of query aligns to 336:517/567 of Q96RQ9
- E481 (≠ D508) mutation to A: Abolished L-amino-acid oxidase activity.
Sites not aligning to the query:
- 1:21 signal peptide
- 92 N → D: increased L-amino-acid oxidase activity; dbSNP:rs111772144
- 102 R → G: in an ovarian cancer; decreased L-amino-acid oxidase activity
- 220 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O24164 Protoporphyrinogen oxidase, mitochondrial; PX-2; Protoporphyrinogen IX oxidase isozyme II; PPO II; PPX II; EC 1.3.3.4 from Nicotiana tabacum (Common tobacco) (see paper)
40% identity, 15% coverage: 42:125/560 of query aligns to 10:92/504 of O24164
Sites not aligning to the query:
- 264 binding
- 473:475 binding
5z2gA Crystal structure of l-amino acid oxidase from venom of naja atra
20% identity, 86% coverage: 48:527/560 of query aligns to 31:468/477 of 5z2gA
- binding flavin-adenine dinucleotide: V34 (= V51), G35 (= G52), G37 (= G54), A39 (= A56), E58 (= E75), A59 (= A76), G65 (= G81), R66 (= R82), G82 (= G99), P83 (≠ G100), M84 (= M101), R85 (= R102), V256 (≠ R298), S287 (≠ T329), I422 (≠ F473), G448 (= G507), E449 (≠ D508), G456 (≠ A515), W457 (= W516), I458 (≠ V517), T461 (≠ A520)
2yg4A Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine (see paper)
43% identity, 13% coverage: 47:121/560 of query aligns to 6:78/449 of 2yg4A
- active site: S61 (≠ P104)
- binding flavin-adenine dinucleotide: V10 (= V51), G11 (= G52), G13 (= G54), P14 (≠ I55), S15 (≠ A56), E34 (= E75), A35 (= A76), R36 (vs. gap), G41 (= G81), R42 (= R82), G56 (= G99), G57 (= G100), Q58 (≠ M101), W59 (≠ R102)
Sites not aligning to the query:
- active site: 196, 295
- binding 4-hydroxybutan-1-aminium: 171, 323, 394
- binding flavin-adenine dinucleotide: 234, 263, 384, 389, 394, 421, 422, 430, 431, 432
2yg3B Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme (see paper)
43% identity, 13% coverage: 47:121/560 of query aligns to 6:78/450 of 2yg3B
- active site: S61 (≠ P104)
- binding flavin-adenine dinucleotide: V10 (= V51), G11 (= G52), G13 (= G54), P14 (≠ I55), S15 (≠ A56), E34 (= E75), A35 (= A76), R36 (vs. gap), G41 (= G81), R42 (= R82), G56 (= G99), G57 (= G100), Q58 (≠ M101), W59 (≠ R102)
Sites not aligning to the query:
- active site: 196, 295
- binding flavin-adenine dinucleotide: 234, 263, 384, 389, 394, 421, 422, 430, 431, 432, 435
Query Sequence
>AO353_07420 FitnessBrowser__pseudo3_N2E3:AO353_07420
MNKNNRHPADGKKPVTIFGPDFPFAFDDWIEHPAGLGSIPAHNHGAEVAIVGAGIAGLVA
AYELMKLGLKPVVYEASKMGGRLRSQAFEGAEGIIAELGGMRFPVSSTAFYHYVDKLGLE
TKPFPNPLTPASGSTVIDLEGQTHYAQKLADLPALFQEVADAWADALEDGSRFGEIQQAI
RDRDVPRLKELWNTLVPLWDDRTFYDFVATSKAFAKLSFHHREVFGQVGFGTGGWDSDFP
NSMLEIFRVVMTNCDDHQHLVVGGVEQVPLGIWRHVPKRCAHWPEGTSLSSLHNGAPRTG
VKRIARAADGRFSVTDNWGDTREYAAVLTTCQSWLLTTQIECEESLFSQKMWMALDRTRY
MQSSKTFVMVDRPFWKDKDPETGRDLMSMTLTDRLTRGTYLFDNGDDKPGVICLSYSWMS
DALKMLPQPIEKRVKLALDALKKIYPKVDIAARIIGDPITVSWEADPHFLGAFKGALPGH
YRYNQRMYAHFMQQDMPAEQRGIFIAGDDVSWTPAWVEGAVQTSLNAVWGIMNHFGGKTH
VENPGPGDVFHEIGPIALPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory