Comparing AO353_07830 FitnessBrowser__pseudo3_N2E3:AO353_07830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3nojA The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida (see paper)
32% identity, 77% coverage: 52:228/231 of query aligns to 47:225/235 of 3nojA
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
31% identity, 64% coverage: 35:182/231 of query aligns to 6:154/156 of 1nxjA
A5W059 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase; HMG/CHA aldolase; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.3.17; EC 4.1.1.112 from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) (see paper)
31% identity, 77% coverage: 52:228/231 of query aligns to 48:226/238 of A5W059
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
26% identity, 58% coverage: 52:185/231 of query aligns to 22:154/158 of 2yjvC
>AO353_07830 FitnessBrowser__pseudo3_N2E3:AO353_07830
MFDVVSSSKWPTGYLINPNVEPLDPKWLKEFSKIPAAAVSDCLGRNVGGLGLKAFHGNAP
MLGSALTVRVRPGDNLMILKAMQMARPGDVLVIDGSADLTRAVFGGIMRAMALKAGIVGV
VINGALRDLDEWQTGELPAYAIGGVHRGPSTDGGGEINVPISCAGMLVAPGDLMIGDGDG
VVAASRSELPELLVRCHDLLAREQATLAAIEAGTLDPDRFDAILRAKGCPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory