SitesBLAST
Comparing AO353_08065 FitnessBrowser__pseudo3_N2E3:AO353_08065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 97% coverage: 5:404/413 of query aligns to 4:354/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), G10 (= G11), V11 (= V12), I12 (= I13), V30 (= V31), E31 (= E32), K32 (≠ R34), E38 (= E40), A39 (≠ T41), S40 (= S42), A43 (≠ N45), G45 (= G47), L46 (≠ Q48), V171 (= V222), G200 (≠ A251), G201 (= G252), W203 (≠ R254), G298 (= G351), R300 (= R353), P301 (= P354), Y326 (≠ G378), R327 (≠ A379), N328 (≠ L380), G329 (= G381), I330 (≠ F382)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
26% identity, 59% coverage: 162:405/413 of query aligns to 115:385/830 of Q9AGP8
- V174 (= V222) binding
- H225 (≠ K271) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ V298) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ LGFT 380:383) binding
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 59% coverage: 162:405/413 of query aligns to 112:382/827 of 3gsiA
- active site: H222 (≠ K271), Y256 (≠ V298)
- binding flavin-adenine dinucleotide: T170 (≠ A221), V171 (= V222), A200 (= A251), G201 (= G252), W203 (vs. gap), H222 (≠ K271), Y256 (≠ V298), G330 (= G351), I331 (≠ M352), F332 (≠ R353), V357 (≠ L380), W358 (≠ G381), V359 (≠ F382), T360 (= T383)
- binding magnesium ion: D254 (= D294)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
26% identity, 59% coverage: 162:405/413 of query aligns to 113:383/828 of 1pj6A
- active site: H223 (≠ K271), Y257 (≠ V298)
- binding flavin-adenine dinucleotide: V172 (= V222), A201 (= A251), G202 (= G252), W204 (vs. gap), H223 (≠ K271), Y257 (≠ V298), G331 (= G351), I332 (≠ M352), V358 (≠ L380), W359 (≠ G381), V360 (≠ F382), T361 (= T383)
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
26% identity, 59% coverage: 162:405/413 of query aligns to 112:382/827 of 1pj7A
- active site: H222 (≠ K271), Y256 (≠ V298)
- binding flavin-adenine dinucleotide: T170 (≠ A221), V171 (= V222), A200 (= A251), G201 (= G252), W203 (vs. gap), H222 (≠ K271), Y256 (≠ V298), I331 (≠ M352), V357 (≠ L380), W358 (≠ G381), V359 (≠ F382), T360 (= T383)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 60% coverage: 164:409/413 of query aligns to 123:366/377 of Q5L2C2
- V180 (= V222) binding
- R309 (= R353) binding
- 334:340 (vs. 377:383, 29% identical) binding
- R336 (≠ A379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 60% coverage: 164:409/413 of query aligns to 122:364/370 of 4yshA
- active site: I262 (≠ V308), L283 (≠ I329), G305 (= G351), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V222), S206 (≠ A251), G207 (= G252), W209 (≠ R254), R307 (= R353), H332 (= H377), R334 (≠ A379), N335 (≠ L380), G336 (= G381), I337 (≠ F382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 60% coverage: 164:409/413 of query aligns to 122:364/368 of 4yshB
- active site: I262 (≠ V308), L283 (≠ I329), G305 (= G351), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V222), S206 (≠ A251), W209 (≠ R254), R307 (= R353), H332 (= H377), R334 (≠ A379), N335 (≠ L380), G336 (= G381), I337 (≠ F382), L338 (≠ T383)
- binding glycine: G249 (≠ I297), Y251 (= Y299), Y251 (= Y299), A264 (= A310), R307 (= R353), R334 (≠ A379), R334 (≠ A379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
6j39A Crystal structure of cmis2 with inhibitor (see paper)
30% identity, 38% coverage: 245:403/413 of query aligns to 197:359/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ L288), Y252 (≠ I297), Y267 (≠ V312), R308 (= R353), R334 (≠ A379), I335 (≠ L380)
- binding flavin-adenine dinucleotide: A203 (= A251), W206 (vs. gap), I228 (≠ S274), Y252 (≠ I297), R308 (= R353), S333 (≠ G378), R334 (≠ A379), I335 (≠ L380), G336 (= G381), V337 (≠ F382), Q338 (≠ T383)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44, 174
6j38A Crystal structure of cmis2 (see paper)
30% identity, 38% coverage: 245:403/413 of query aligns to 197:359/368 of 6j38A
- binding flavin-adenine dinucleotide: A203 (= A251), W206 (vs. gap), G226 (= G272), G306 (= G351), R308 (= R353), S333 (≠ G378), R334 (≠ A379), I335 (≠ L380), G336 (= G381), V337 (≠ F382), Q338 (≠ T383)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44, 174
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
53% identity, 10% coverage: 5:47/413 of query aligns to 6:48/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), I14 (= I13), E33 (= E32), K34 (≠ A33), E41 (= E40), T42 (= T41), S43 (= S42), A45 (= A44), N46 (= N45), S47 (≠ G46)
- binding sn-glycerol-3-phosphate: S47 (≠ G46)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 49, 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
53% identity, 10% coverage: 5:47/413 of query aligns to 6:48/384 of P75063
Sites not aligning to the query:
- 47:49 binding
- 177 binding
- 346:347 binding
- 352 binding
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 56% coverage: 166:396/413 of query aligns to 120:346/369 of S5FMM4
- S202 (≠ A251) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ F382) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L392) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
Query Sequence
>AO353_08065 FitnessBrowser__pseudo3_N2E3:AO353_08065
MAQRVCIIGGGVIGLTTAYALVRDGFEVTVVEARDSLGSETSFANGGQLSYRYVAPLADA
GVPLQAIGWMLRGDSPLKLRMRFDPAQWRWMASFLGACRTSVNRQNAAHLLRLALLSQTT
LQGWREEDSLDGFNWRRNGKLVTFRQAASFEHARNSLVDPQQQQVLSPTESARLEPALAD
AAFVGAIYTPDEEVGDCHAFCQQLMKRLKASGLCEFRLGRAVTGIRHVDGAVSAIELADE
VLPVEQLVIAAGHRSPLLALPGVHLPLYPLKGYSLTVPIGAEHRAPDLSITDYDRKIVYA
RIGEQLRVAAMVDIVGFDPAPDPKRLALIKRQACDTFPNAGTYDAAVEWAGMRPATPSGV
PLLGATAYRNLWLNLGHGALGFTLACGSARVLSELIGQRNPSIDLQGFTHRAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory