Comparing AO353_08135 FitnessBrowser__pseudo3_N2E3:AO353_08135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pnzA The structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
38% identity, 89% coverage: 18:315/334 of query aligns to 1:288/293 of 6pnzA
3r7lA Crystal structure of pala-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
38% identity, 90% coverage: 18:319/334 of query aligns to 1:289/290 of 3r7lA
3r7fA Crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
38% identity, 90% coverage: 18:319/334 of query aligns to 1:289/291 of 3r7fA
3r7dA Crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis (see paper)
38% identity, 90% coverage: 18:319/334 of query aligns to 1:289/291 of 3r7dA
P05654 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Bacillus subtilis (strain 168) (see paper)
38% identity, 90% coverage: 18:319/334 of query aligns to 1:289/304 of P05654
Sites not aligning to the query:
4bjhB Crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) (see paper)
38% identity, 91% coverage: 18:320/334 of query aligns to 1:291/291 of 4bjhB
3d6nB Crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase (see paper)
38% identity, 91% coverage: 18:320/334 of query aligns to 1:291/291 of 3d6nB
8bplA Aspartate transcarbamoylase mutant (n2045c, r2238c) from chaetomium thermophilum cad-like bound to carbamoyl phosphate (see paper)
36% identity, 90% coverage: 20:320/334 of query aligns to 17:316/316 of 8bplA
4eknB Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form (see paper)
36% identity, 90% coverage: 18:316/334 of query aligns to 1:297/304 of 4eknB
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
32% identity, 90% coverage: 19:319/334 of query aligns to 1924:2222/2225 of P08955
Sites not aligning to the query:
2hseA Structure of d236a e. Coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2hseA
2a0fA Structure of d236a mutant e. Coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2a0fA
2ipoA E. Coli aspartate transcarbamoylase complexed with n-phosphonacetyl-l- asparagine (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2ipoA
2h3eA Structure of wild-type e. Coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2h3eA
2fzkA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.50 resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2fzkA
2fzgA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.25 resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2fzgA
2fzcA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.10 resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2fzcA
2airA T-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 2airA
1za2A Structure of wild-type e. Coli aspartate transcarbamoylase in the presence of ctp, carbamoyl phosphate at 2.50 a resolution (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 1za2A
1r0cA Products in the t state of aspartate transcarbamylase: crystal structure of the phosphate and n-carbamyl-l-aspartate ligated enzyme (see paper)
35% identity, 90% coverage: 19:320/334 of query aligns to 7:305/310 of 1r0cA
>AO353_08135 FitnessBrowser__pseudo3_N2E3:AO353_08135
MTPLDTKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGIEQYGVKVYTDMTEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQFEQEKAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory