Comparing AO353_10285 FitnessBrowser__pseudo3_N2E3:AO353_10285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
35% identity, 93% coverage: 5:197/207 of query aligns to 4:199/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
33% identity, 95% coverage: 3:198/207 of query aligns to 1:199/206 of 4hz2B
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
32% identity, 92% coverage: 4:194/207 of query aligns to 3:195/214 of 3wywB
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
33% identity, 92% coverage: 4:194/207 of query aligns to 2:204/213 of 5f06A
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
33% identity, 94% coverage: 1:194/207 of query aligns to 3:198/222 of 3zmkB
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
34% identity, 91% coverage: 6:194/207 of query aligns to 5:195/220 of 2imkA
Sites not aligning to the query:
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
33% identity, 86% coverage: 14:192/207 of query aligns to 12:193/204 of 4ecjA
Sites not aligning to the query:
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
32% identity, 91% coverage: 6:194/207 of query aligns to 5:195/220 of 4gsnB
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
31% identity, 92% coverage: 4:194/207 of query aligns to 1:193/209 of 1pn9A
Sites not aligning to the query:
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
32% identity, 92% coverage: 4:194/207 of query aligns to 2:177/183 of 8ai8A
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
32% identity, 92% coverage: 4:194/207 of query aligns to 2:177/183 of 7pkaA
6tahB Glutathione S-transferase
32% identity, 86% coverage: 14:192/207 of query aligns to 13:194/213 of 6tahB
Sites not aligning to the query:
4ri6A Crystal structure of poplar glutathione transferase f1 (see paper)
29% identity, 89% coverage: 4:188/207 of query aligns to 4:198/214 of 4ri6A
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
30% identity, 91% coverage: 4:192/207 of query aligns to 1:196/203 of 4l8eA
3gx0A Crystal structure of gsh-dependent disulfide bond oxidoreductase (see paper)
30% identity, 91% coverage: 4:192/207 of query aligns to 2:197/204 of 3gx0A
3ljrA Glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate (see paper)
31% identity, 81% coverage: 27:193/207 of query aligns to 26:202/244 of 3ljrA
Sites not aligning to the query:
P0CG30 Glutathione S-transferase theta-2B; Glutathione S-transferase theta-2; GST class-theta-2; EC 2.5.1.18 from Homo sapiens (Human) (see 2 papers)
31% identity, 81% coverage: 27:193/207 of query aligns to 26:202/244 of P0CG30
Sites not aligning to the query:
P77526 Disulfide-bond oxidoreductase YfcG; GSH-dependent disulfide-bond oxidoreductase YfcG; GST N1-1; GST-like protein YfcG; Organic hydroperoxidase; EC 1.8.4.-; EC 1.11.1.- from Escherichia coli (strain K12) (see 2 papers)
30% identity, 91% coverage: 4:192/207 of query aligns to 2:197/215 of P77526
O80852 Glutathione S-transferase F9; AtGSTF9; AtGSTF7; GST class-phi member 9; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 80% coverage: 30:194/207 of query aligns to 28:204/215 of O80852
Sites not aligning to the query:
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
31% identity, 91% coverage: 4:192/207 of query aligns to 33:234/246 of 4nhzH
>AO353_10285 FitnessBrowser__pseudo3_N2E3:AO353_10285
MHAIKLYNFPRSGHAHRVELMLSLLELPTELIFVDLAKGAHKQPDFLALNAFGQVPVIDD
QGVVLADSNAILVYLAQKYGKGRWLPADPVGAARVQRWLSIAAGPIAFGPAIARLITVFG
APNNADEVITRSHNLLKVIDQELSKSTYLAGDEPTIADVAAYSYIAHAPEGNVSLADYAN
VRAWLARIEALPGFVGMPRTVAGLQTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory