SitesBLAST
Comparing AO353_10710 FitnessBrowser__pseudo3_N2E3:AO353_10710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
72% identity, 94% coverage: 14:394/406 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H94), K82 (= K95), Q109 (≠ M122), S185 (≠ T198), G227 (= G240), G229 (= G242), S230 (= S243), N231 (= N244), E345 (= E358), S371 (= S384), G372 (= G385)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
61% identity, 95% coverage: 10:393/406 of query aligns to 10:396/406 of 5tciH
- active site: K98 (= K95), E120 (= E117), S387 (= S384)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ A25), L31 (= L28), Y197 (= Y194), F199 (≠ I196), P205 (= P202), F208 (≠ Y205), H291 (= H288)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
61% identity, 95% coverage: 10:393/406 of query aligns to 10:396/405 of 6u6cB
- active site: K98 (= K95), E120 (= E117), S387 (= S384)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H94), K98 (= K95), T121 (= T118), G122 (= G119), A123 (= A120), Q125 (≠ M122), H126 (= H123), T201 (= T198), G243 (= G240), G245 (= G242), S246 (= S243), N247 (= N244), G314 (= G311), E361 (= E358), S387 (= S384)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y23), F185 (≠ L182), W188 (= W185), Y197 (= Y194), F199 (≠ I196), G204 (= G201), P205 (= P202), H291 (= H288), G292 (= G289)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
61% identity, 95% coverage: 10:393/406 of query aligns to 9:395/405 of 6uapB
- active site: K97 (= K95), E119 (= E117), S386 (= S384)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M178), N181 (= N179), F184 (≠ L182), Y196 (= Y194), F198 (≠ I196), P204 (= P202), F207 (≠ Y205), H290 (= H288)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
61% identity, 95% coverage: 10:393/406 of query aligns to 5:391/399 of 5ocwB
- active site: K93 (= K95), E115 (= E117), S382 (= S384)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H94), K93 (= K95), T116 (= T118), G117 (= G119), A118 (= A120), Q120 (≠ M122), H121 (= H123), T196 (= T198), G238 (= G240), G240 (= G242), S241 (= S243), N242 (= N244), G309 (= G311), E356 (= E358), S382 (= S384)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
61% identity, 95% coverage: 10:393/406 of query aligns to 9:395/404 of 6usaB
- active site: K97 (= K95), E119 (= E117), S386 (= S384)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H94), K97 (= K95), T120 (= T118), G121 (= G119), A122 (= A120), G123 (= G121), Q124 (≠ M122), H125 (= H123), T200 (= T198), G242 (= G240), G244 (= G242), S245 (= S243), N246 (= N244), G313 (= G311), E360 (= E358), S386 (= S384)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L182), W187 (= W185), Y196 (= Y194), F198 (≠ I196), G203 (= G201), P204 (= P202), F207 (≠ Y205), H290 (= H288), G291 (= G289)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
61% identity, 95% coverage: 10:393/406 of query aligns to 9:395/404 of 6dweB
- active site: K97 (= K95), E119 (= E117), S386 (= S384)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L182), Y196 (= Y194), F198 (≠ I196), P204 (= P202), F207 (≠ Y205), H290 (= H288)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H94), K97 (= K95), T120 (= T118), G121 (= G119), A122 (= A120), G123 (= G121), Q124 (≠ M122), H125 (= H123), T200 (= T198), G242 (= G240), G244 (= G242), S245 (= S243), N246 (= N244), G313 (= G311), E360 (= E358), S386 (= S384)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/386 of 1v8zA
- active site: K82 (= K95), E104 (= E117), S371 (= S384)
- binding pyridoxal-5'-phosphate: H81 (= H94), K82 (= K95), Q109 (≠ M122), S185 (≠ T198), G227 (= G240), G228 (= G241), G229 (= G242), S230 (= S243), N231 (= N244), E345 (= E358), S371 (= S384), G372 (= G385)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/388 of 5dw0A
- active site: K82 (= K95), E104 (= E117), S371 (= S384)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H94), K82 (= K95), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G227 (= G240), G229 (= G242), S230 (= S243), N231 (= N244), G298 (= G311), D300 (= D313), E345 (= E358), S371 (= S384)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/385 of 6am8B
- active site: K82 (= K95), E104 (= E117), S371 (= S384)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H94), K82 (= K95), E104 (= E117), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), L161 (= L174), S185 (≠ T198), V187 (≠ A200), G227 (= G240), G228 (= G241), G229 (= G242), S230 (= S243), N231 (= N244), G298 (= G311), Y301 (= Y314), E345 (= E358), S371 (= S384), G372 (= G385)
- binding tryptophan: P12 (≠ A25), L169 (= L182), S274 (≠ L287), H275 (= H288)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:381/383 of 5dw3A
- active site: K82 (= K95), E104 (= E117), S370 (= S384)
- binding tryptophan: K82 (= K95), E104 (= E117), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G228 (= G241), Y300 (= Y314)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:380/383 of 5t6mA
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H94), K82 (= K95), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G227 (= G240), G229 (= G242), S230 (= S243), N231 (= N244), G298 (= G311), E345 (= E358), S371 (= S384)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:380/394 of 5ixjD
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:382/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H94), K82 (= K95), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G227 (= G240), G229 (= G242), S230 (= S243), N231 (= N244), G298 (= G311), E345 (= E358), S371 (= S384)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
61% identity, 94% coverage: 16:395/406 of query aligns to 3:380/383 of 5vm5D
- active site: K82 (= K95), E104 (= E117), S369 (= S384)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H94), K82 (= K95), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G227 (= G240), G229 (= G242), S230 (= S243), N231 (= N244), G296 (= G311), E343 (= E358), S369 (= S384)
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
61% identity, 95% coverage: 14:397/406 of query aligns to 1:379/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H94), K81 (= K95), T104 (= T118), G105 (= G119), A106 (= A120), Q108 (≠ M122), H109 (= H123), S184 (≠ T198), G228 (= G242), S229 (= S243), N230 (= N244), G296 (= G311), E343 (= E358), S366 (= S384)
- binding quinolin-4-ol: G103 (≠ E117), L160 (= L174), I164 (≠ M178), G183 (= G197), S184 (≠ T198), Y299 (= Y314)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
61% identity, 95% coverage: 13:397/406 of query aligns to 1:380/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H94), K82 (= K95), T105 (= T118), G106 (= G119), A107 (= A120), Q109 (≠ M122), H110 (= H123), S185 (≠ T198), G229 (= G242), S230 (= S243), N231 (= N244), G297 (= G311), E344 (= E358), S367 (= S384)
Query Sequence
>AO353_10710 FitnessBrowser__pseudo3_N2E3:AO353_10710
MTQTNLRNGPDANGLFGAFGGRYVAETLMPLILDLAREYEAAKDDPAFKEELAYFQRDYV
GRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGA
GMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKDAMNE
ALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLQAKEGRLPDSLVACIG
GGSNAMGLFHPFLDDKSVEIIGVEAAGHGIETGKHAASLNGGVPGVLHGNRTFLLQDDDG
QIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDHEALDAFHKCCRLEGIIPALESA
HALAEVFKRAPTLPKDHLMVVNLSGRGDKDMQTVMHHMDQSQQEKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory