SitesBLAST
Comparing AO353_10800 AO353_10800 alcohol dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
54% identity, 95% coverage: 20:434/435 of query aligns to 36:449/478 of Q47945
- Q37 (≠ E21) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
54% identity, 95% coverage: 23:434/435 of query aligns to 1:411/433 of 8gy2B
- binding heme c: C18 (= C40), C21 (= C43), H22 (= H44), T46 (= T68), I48 (= I70), Y59 (= Y80), L68 (≠ V89), R73 (≠ A94), V79 (≠ L100), Y80 (= Y101), M83 (= M104), F88 (≠ Y109), R126 (= R147), H165 (= H186), C166 (= C187), C169 (= C190), H170 (= H191), I201 (= I222), A202 (= A223), P203 (≠ K224), L205 (= L226), W216 (= W237), F224 (= F245), A234 (= A255), V235 (= V256), F236 (= F257), F236 (= F257), M239 (= M260), N301 (= N322), C302 (= C323), C305 (= C326), H306 (= H327), M316 (≠ V337), F317 (= F338), P318 (= P339), L320 (= L341), P324 (= P345), G342 (≠ A363), S352 (= S373), V354 (≠ F375), M356 (= M377), F359 (= F380), M375 (≠ I396)
- binding ubiquinone-10: C21 (= C43), L34 (= L56), P39 (= P61), P81 (= P102), L129 (= L150), W132 (= W153), E168 (≠ A189), R173 (= R194), I197 (≠ L218), D241 (= D262)
Sites not aligning to the query:
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 89% coverage: 28:416/435 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (= T68), I44 (= I70), F60 (= F85), L64 (≠ V89), L75 (= L100), Y76 (= Y101), M79 (= M104), P80 (= P105), Y84 (= Y109), R122 (= R147), C162 (= C187), C165 (= C190), H166 (= H191), I186 (≠ L218), W189 (= W221), A191 (= A223), P192 (≠ K224), I194 (≠ L226), W205 (= W237), Y213 (≠ F245), R223 (≠ A255), M228 (= M260), V303 (≠ N322), C304 (= C323), C307 (= C326), H308 (= H327), Y320 (≠ F338), P321 (= P339), L323 (= L341), T327 (≠ P345), T328 (≠ V346), D336 (≠ S354), I341 (≠ V359), V345 (≠ A363), R347 (≠ L365), I354 (≠ F375), M356 (= M377), F359 (= F380), I376 (≠ V392)
- binding ubiquinone-10: M36 (≠ I62), P77 (= P102), S124 (≠ P149), W128 (= W153), C165 (= C190), L173 (≠ S204)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 89% coverage: 28:416/435 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (= T68), I44 (= I70), Y55 (= Y80), L75 (= L100), Y76 (= Y101), A78 (= A103), M79 (= M104), R122 (= R147), H161 (= H186), C162 (= C187), C165 (= C190), H166 (= H191), A191 (= A223), P192 (≠ K224), R223 (≠ A255), P227 (≠ G259), M228 (= M260), V289 (≠ N322), C290 (= C323), C293 (= C326), H294 (= H327), Y305 (≠ V337), Y306 (≠ F338), P307 (= P339), L309 (= L341), N312 (= N344), T313 (≠ P345), T314 (≠ V346), D322 (≠ S354), I327 (≠ V359), V331 (≠ A363), R333 (≠ L365), I340 (≠ F375), M342 (= M377), P343 (= P378), F345 (= F380)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 88% coverage: 19:399/435 of query aligns to 32:410/440 of 8gy3A
- binding heme c: Y52 (≠ D39), C53 (= C40), C56 (= C43), H57 (= H44), S84 (≠ T68), I86 (= I70), W97 (≠ Y80), F102 (= F85), L117 (= L100), F121 (≠ M104), F126 (≠ Y109), R163 (= R147), C203 (= C187), C206 (= C190), H207 (= H191), A232 (= A223), P233 (≠ K224), L235 (= L226), W245 (= W237), Y253 (≠ F245), L254 (= L246), G263 (≠ S254), S264 (≠ A255), M269 (= M260), Y292 (≠ L283), C337 (= C323), C340 (= C326), H341 (= H327), P353 (= P339), L355 (= L341), N358 (= N344), N359 (≠ P345), V372 (≠ I358), I377 (≠ A363), G382 (≠ A371), Q383 (≠ P372), I386 (≠ F375), M388 (= M377), F391 (= F380)
- binding ubiquinone-10: E55 (≠ A42), T76 (= T60), F78 (≠ I62), Y118 (= Y101), P119 (= P102), I160 (≠ L144), G166 (≠ L150), Q167 (≠ T151), F169 (vs. gap), W170 (= W153), H202 (= H186), R210 (= R194), L213 (≠ T197)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
30% identity, 23% coverage: 316:416/435 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C323), C33 (= C326), H34 (= H327), Y46 (≠ F338), P47 (= P339), T54 (≠ V346), V66 (≠ I358), I67 (≠ V359), R73 (≠ T368), I80 (≠ F375), M82 (= M377), P83 (= P378)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
32% identity, 25% coverage: 308:416/435 of query aligns to 332:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C323), C350 (= C326), H351 (= H327), F362 (= F338), P363 (= P339), P364 (≠ A340), L365 (= L341), S368 (≠ N344), Y370 (≠ V346), I382 (≠ V359), L386 (≠ A363), S387 (≠ T364), G388 (≠ L365), I390 (vs. gap), V392 (≠ T368), Y397 (≠ S373), N398 (≠ T374), G399 (≠ F375), V400 (≠ T376), M401 (= M377)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
30% identity, 26% coverage: 302:416/435 of query aligns to 339:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N322), C360 (= C323), C363 (= C326), H364 (= H327), P376 (= P339), P377 (≠ A340), L378 (= L341), F383 (≠ V346), N400 (≠ T364), G401 (≠ L365), Y410 (≠ T374), S412 (≠ T376), M414 (≠ P378), M417 (≠ A381)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
30% identity, 26% coverage: 302:416/435 of query aligns to 342:455/457 of 4ax3D
- binding heme c: C363 (= C323), C366 (= C326), H367 (= H327), P379 (= P339), P380 (≠ A340), L381 (= L341), S384 (≠ N344), F386 (≠ V346), N403 (≠ T364), G404 (≠ L365), S415 (≠ T376), M417 (≠ P378), M420 (≠ A381)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
30% identity, 26% coverage: 302:416/435 of query aligns to 340:453/456 of 5oboA
- binding heme c: T360 (≠ N322), C361 (= C323), C364 (= C326), H365 (= H327), P377 (= P339), P378 (≠ A340), L379 (= L341), S382 (≠ N344), F384 (≠ V346), I395 (= I358), N401 (≠ T364), G402 (≠ L365), S413 (≠ T376), M415 (≠ P378), M418 (≠ A381)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
31% identity, 25% coverage: 315:423/435 of query aligns to 2:114/129 of 1dt1A
- binding heme c: C9 (= C323), C12 (= C326), H13 (= H327), P25 (= P339), H30 (≠ N344), Y43 (≠ L355), V47 (= V359), Q53 (≠ L365), G54 (≠ P366), G65 (vs. gap), M67 (= M377), F70 (= F380)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
31% identity, 25% coverage: 315:423/435 of query aligns to 4:116/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C323), C14 (= C326), H15 (= H327), F26 (= F338), P27 (= P339), L29 (= L341), H32 (≠ N344), Y45 (≠ L355), L54 (≠ T364), Q55 (≠ L365), G56 (≠ P366), G67 (vs. gap), M69 (= M377), F72 (= F380)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
31% identity, 25% coverage: 315:423/435 of query aligns to 3:115/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C326), H14 (= H327), P26 (= P339), L28 (= L341), H31 (≠ N344), Y44 (≠ L355), V48 (= V359), Q54 (≠ L365), G55 (≠ P366), G66 (vs. gap), M68 (= M377)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
31% identity, 25% coverage: 315:423/435 of query aligns to 3:115/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y319), C10 (= C323), C13 (= C326), H14 (= H327), P26 (= P339), H31 (≠ N344), Y44 (≠ L355), Q54 (≠ L365), G55 (≠ P366), G66 (vs. gap), M68 (= M377), F71 (= F380)
Sites not aligning to the query:
Query Sequence
>AO353_10800 AO353_10800 alcohol dehydrogenase
MKNLVIATLALLGSCSISAAEDASQALIKQGEYLARAGDCVACHTAKGGKPFAGGLPMET
PIGTIYSTNITPDKTGLGDYSFDDFDKAVRHGVAKNGSTLYPAMPYPSYARVSDADMKAL
YAYFMKGVAPVTQENKGSDIPWPLSMRWPLTGWRWMFAPSVVAYQPADGKEAAISRGAYL
VEGLGHCGACHTPRALTMQEKALSANEGSAFLSGSAPLEGWIAKSLRGDHKDGLGSWSEE
QLVQFLKTGRSDRSAVFGGMSDVVEHSMQYMSDDDLTAIARYLKSLPANDPNDQPHPYDP
QVAQALWKGDDSKPGASVYIDNCAACHRTDGHGYTRVFPALAGNPVLQSDDPVSLINIVL
KGATLPATHTAPSTFTMPAFAWRLSDQEVADVVNFIRTSWGNKGAQIKPADVADVRKDEV
KSMPADKSGKLTSSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory