Comparing AO353_11210 FitnessBrowser__pseudo3_N2E3:AO353_11210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
41% identity, 66% coverage: 39:228/286 of query aligns to 41:237/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
41% identity, 66% coverage: 39:228/286 of query aligns to 41:237/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
40% identity, 66% coverage: 39:228/286 of query aligns to 41:237/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 67% coverage: 37:228/286 of query aligns to 19:217/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 69% coverage: 42:237/286 of query aligns to 35:229/378 of P69874
Sites not aligning to the query:
1g291 Malk (see paper)
37% identity, 67% coverage: 37:228/286 of query aligns to 16:214/372 of 1g291
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 73% coverage: 19:227/286 of query aligns to 2:208/393 of P9WQI3
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 73% coverage: 19:227/286 of query aligns to 1:205/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
36% identity, 73% coverage: 19:227/286 of query aligns to 1:207/363 of 8hprC
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 73% coverage: 19:227/286 of query aligns to 1:207/362 of 8hprD
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
36% identity, 66% coverage: 39:228/286 of query aligns to 21:203/353 of 1vciA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 65% coverage: 43:228/286 of query aligns to 20:210/240 of 4ymuJ
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
37% identity, 64% coverage: 42:224/286 of query aligns to 18:198/348 of 3d31A
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
35% identity, 72% coverage: 20:226/286 of query aligns to 3:215/226 of 5xu1B
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 69% coverage: 33:228/286 of query aligns to 14:210/241 of 4u00A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 69% coverage: 20:215/286 of query aligns to 1:202/343 of P30750
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
35% identity, 73% coverage: 20:228/286 of query aligns to 1:219/232 of 1f3oA
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 69% coverage: 20:215/286 of query aligns to 2:203/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 69% coverage: 20:215/286 of query aligns to 2:203/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 69% coverage: 20:215/286 of query aligns to 2:203/344 of 6cvlD
>AO353_11210 FitnessBrowser__pseudo3_N2E3:AO353_11210
MNARLQGHAASSSTASTQALLAVDHVSLEYRTPQRVVRATHQVSFEVDPADRFVLLGPSG
CGKSTLLKAVAGFIAPCEGQIRLQGQAVSAPGPDRIVVFQEFDQLPPWKTVKQNVMFPLL
ASQTLKRREAEERALRYLDKVGLAAFADAYPHTLSGGMKARVAIARALAMQPKILLMDEP
FAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRAEIHS
HQYDLHSLGGVAFQQSARRIHRLLFDEGQSAESDHELDFNDIRIAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory