Comparing AO353_11605 FitnessBrowser__pseudo3_N2E3:AO353_11605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
28% identity, 92% coverage: 14:215/219 of query aligns to 13:213/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
28% identity, 92% coverage: 14:215/219 of query aligns to 13:213/215 of 4ymtC
>AO353_11605 FitnessBrowser__pseudo3_N2E3:AO353_11605
MASSGLELLWVSLPQLGKGAAQTLSISFLSIAISTVGGVLYGVLCSLNSKWLNALLRVYL
ELFRAIPVLVWLYLLFFGLPIFFGLSLPSFWCAVLVLSLWGASEVGEVVRGALHSLPRGQ
REAGLSIGLSGPQLFGYVLLPQALKRMTPPTINVYTRIIKTSSLAVLIGVVDVIKVGQQI
IERTYESVLIYGALFLFFFFICYPLSAASRVLERRWTQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory