Comparing AO353_11915 FitnessBrowser__pseudo3_N2E3:AO353_11915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
56% identity, 99% coverage: 1:364/368 of query aligns to 1:373/374 of G7JT50
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
57% identity, 96% coverage: 12:364/368 of query aligns to 2:359/360 of 6nicD
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
55% identity, 97% coverage: 7:364/368 of query aligns to 7:366/369 of 3h7cX
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
53% identity, 99% coverage: 1:364/368 of query aligns to 1:373/383 of Q8GWW7
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
52% identity, 97% coverage: 6:363/368 of query aligns to 8:363/365 of Q837U5
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
27% identity, 94% coverage: 18:362/368 of query aligns to 15:328/333 of 6b2wA
>AO353_11915 FitnessBrowser__pseudo3_N2E3:AO353_11915
MTTLHSTPRADGFYMPAEWATQTQTWMVWPERPDNWRLGGKPAQAAHVAVAKAIARFEPV
TVAVSAAQYENARARLDVPNIRLVEMSSDDAWVRDTGPTFVINNSGEVRGVDWDFNAWGG
FDGGLYSPWNRDSQVAGKILEIERSPRYRTEGFVLEGGSIHVDGEGTLITTEECLLNRNR
NPHMSRADIEAVLSAQLAVDKIIWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQD
PNYPRCQAAMKVLQSTKDAKGRPFKVHKMPIPGPLYATEEECAGVDPVDGTQERNPSVRL
AGSYVNFLIVNGGIIAPSFDDPLDAQAKEILQNLFPQHEVVMVPGRELLLGGGNIHCLTQ
QQPAPHKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory