Comparing AO353_12365 FitnessBrowser__pseudo3_N2E3:AO353_12365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
46% identity, 76% coverage: 5:104/132 of query aligns to 6:104/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
46% identity, 76% coverage: 5:104/132 of query aligns to 8:106/213 of 7bgmA
Sites not aligning to the query:
6j2lA Crystal structure of bi-functional enzyme (see paper)
40% identity, 73% coverage: 7:103/132 of query aligns to 8:104/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
38% identity, 67% coverage: 7:95/132 of query aligns to 7:96/185 of 6j2lB
Sites not aligning to the query:
>AO353_12365 FitnessBrowser__pseudo3_N2E3:AO353_12365
MKDWLDEIKWDSDGLVPAIAQDHKTGRVLMMAWMNREALELTAAENRAIYWSRSRGKLWR
KGEESGHVQTLHEMRLDCDADVIILMVEQIGDIACHTGRQSCFYRVYENGDWKTVDPVLK
DPHAIYSDHKHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory