Comparing AO353_14425 FitnessBrowser__pseudo3_N2E3:AO353_14425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yhvA Crystal structure of an aminotransferase from mycobacterium tuberculosis
37% identity, 96% coverage: 12:387/390 of query aligns to 17:393/394 of 5yhvA
P96847 Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
37% identity, 96% coverage: 12:387/390 of query aligns to 11:387/388 of P96847
5yhvB Crystal structure of an aminotransferase from mycobacterium tuberculosis
37% identity, 96% coverage: 12:387/390 of query aligns to 10:386/387 of 5yhvB
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
37% identity, 98% coverage: 6:387/390 of query aligns to 3:370/370 of Q58097
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
34% identity, 98% coverage: 6:387/390 of query aligns to 11:384/384 of 1o4sB
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/382 of 1gc3A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/382 of 1b5oA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
34% identity, 97% coverage: 6:385/390 of query aligns to 5:382/385 of Q56232
1j32A Aspartate aminotransferase from phormidium lapideum
29% identity, 97% coverage: 6:385/390 of query aligns to 4:384/388 of 1j32A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
33% identity, 97% coverage: 6:385/390 of query aligns to 3:396/399 of 5wmhA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
33% identity, 97% coverage: 6:385/390 of query aligns to 4:396/402 of 5wmiA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
33% identity, 97% coverage: 6:385/390 of query aligns to 4:397/404 of 5wmlA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 93% coverage: 26:386/390 of query aligns to 19:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 93% coverage: 26:386/390 of query aligns to 19:383/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 89% coverage: 34:381/390 of query aligns to 37:391/402 of P14909
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
30% identity, 95% coverage: 12:383/390 of query aligns to 10:393/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 95% coverage: 12:383/390 of query aligns to 11:394/400 of Q02635
>AO353_14425 FitnessBrowser__pseudo3_N2E3:AO353_14425
MAQPYSARSRAIEPFHVMALLARANELQAAGHDVIHLEIGEPDFTTAEPIIKAGQAALTA
GKTRYTAARGIPELREAISGFYEQRYGLNIDPQRILITPGGSGALLLASALLVDPGKHWL
LADPGYPCNRHFLRLVEGAAQLVPVGPDVRYQLTPGLVERYWDHDSVGALVASPANPTGT
ILTRDELAGLSAAIKERHGHLVVDEIYHGLTYGTDAASVLEVDDSAFVLNSFSKYFGMTG
WRLGWLVAPEAAVGELEKLAQNLYISAPSMAQHAALACFEPDTISILEERRAEFGRRRDF
LLPALRELGFGIAVEPEGAFYLYADISAFGGDAFAFCRHFLETEHVAFTPGLDFGRYQAG
HHVRFAYTQSLPRLQEAVQRIARGLRSWQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory