Comparing AO353_14450 FitnessBrowser__pseudo3_N2E3:AO353_14450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 97% coverage: 4:251/255 of query aligns to 14:261/265 of P07821
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 92% coverage: 1:235/255 of query aligns to 2:233/240 of 6mjpA
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
37% identity, 84% coverage: 23:237/255 of query aligns to 21:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
36% identity, 85% coverage: 23:239/255 of query aligns to 21:233/248 of 4fi3C
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 89% coverage: 1:226/255 of query aligns to 1:216/348 of 3d31A
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
33% identity, 87% coverage: 2:222/255 of query aligns to 4:224/262 of 7chaI
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 89% coverage: 1:226/255 of query aligns to 1:224/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 82% coverage: 17:226/255 of query aligns to 21:228/280 of 5x40A
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 85% coverage: 12:228/255 of query aligns to 330:542/865 of O65934
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
30% identity, 94% coverage: 1:239/255 of query aligns to 1:238/276 of Q5M243
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 92% coverage: 1:235/255 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 92% coverage: 1:235/255 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 92% coverage: 1:235/255 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 92% coverage: 1:235/255 of query aligns to 3:242/242 of 2oljA
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
32% identity, 84% coverage: 2:215/255 of query aligns to 331:541/585 of 6tejB
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 92% coverage: 2:235/255 of query aligns to 3:233/233 of 6b8bA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 2:226/253 of 6z5uK
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 92% coverage: 2:235/255 of query aligns to 3:233/235 of 6mhzA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 4:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 4:228/263 of 7d08B
>AO353_14450 FitnessBrowser__pseudo3_N2E3:AO353_14450
MLRVENLQICRGKKIVLADIDLELKPGEVLGVLGPNGAGKSTLLGALCGELRPDHGRVWL
DQRELSQWDGAQRAQRLAVLPQTSTLDFAFRVEEVVGMGRLPHQTGRVRDDEIVAAALQA
ADVGHLSGRSYLALSGGERQRVHLARVLAQLWPGEAGQTLLLDEPTSMLDPLHQHTTLQA
IREFADRGAAVLVILHDLNLAARYCDRILLLESGRPHALDTPQQVLRPEPLKAVFGLDVL
VQPHPERGHPLIIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory