Comparing AO353_14875 FitnessBrowser__pseudo3_N2E3:AO353_14875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
29% identity, 87% coverage: 9:274/305 of query aligns to 5:271/291 of 3na8A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
30% identity, 94% coverage: 7:293/305 of query aligns to 2:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
30% identity, 94% coverage: 7:293/305 of query aligns to 2:289/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
30% identity, 94% coverage: 7:293/305 of query aligns to 3:290/293 of 5t25A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
29% identity, 91% coverage: 7:283/305 of query aligns to 3:284/298 of 3nevA
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
30% identity, 94% coverage: 7:293/305 of query aligns to 2:289/292 of 3i7sA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 94% coverage: 6:291/305 of query aligns to 4:290/295 of 5ktlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
31% identity, 78% coverage: 7:244/305 of query aligns to 2:240/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 78% coverage: 7:244/305 of query aligns to 2:240/294 of 4i7wA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
29% identity, 89% coverage: 11:282/305 of query aligns to 6:279/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
29% identity, 89% coverage: 11:282/305 of query aligns to 6:279/296 of 7lvlA
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
29% identity, 93% coverage: 6:290/305 of query aligns to 1:301/307 of 5c55A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 80% coverage: 7:251/305 of query aligns to 2:249/292 of Q07607
4pfmA Shewanella benthica dhdps with lysine and pyruvate
30% identity, 72% coverage: 8:228/305 of query aligns to 4:220/295 of 4pfmA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
27% identity, 90% coverage: 7:280/305 of query aligns to 5:276/295 of Q5HG25
>AO353_14875 FitnessBrowser__pseudo3_N2E3:AO353_14875
MSKHVNWSGVFPAVTTQFNPDFSIDYEGTHKVISGLVRDGVSGLVICGTVGENTSLSTEE
KISLVEVAKDAAAGRVPVISGVAEFTSANASKVAKEIQRVGADGIMLMPALVYSSKPFET
AAHFRSVAASIDLPVMVYNNPPIYRNDVTPDILISLADCDNVVCFKDSSGDTRRFIDVRN
EVGDRFVLFAGLDDVVLESIAVGAVGWVSGMSNAFPKEGETLFRLARDGRFKEAMPIYEW
FMPLLHLDARPDLVQCIKLCEELMGRGTALTRPPRLGLLDHERSEVEALVKAALANRPSL
PDVGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory