Comparing AO353_15110 FitnessBrowser__pseudo3_N2E3:AO353_15110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 73% coverage: 56:380/448 of query aligns to 45:409/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 73% coverage: 56:380/448 of query aligns to 45:409/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 73% coverage: 56:380/448 of query aligns to 45:409/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 73% coverage: 56:380/448 of query aligns to 49:413/491 of P0AGF4
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 74% coverage: 72:403/448 of query aligns to 85:409/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
21% identity, 81% coverage: 85:448/448 of query aligns to 63:438/446 of A0A0H2VG78
Sites not aligning to the query:
>AO353_15110 FitnessBrowser__pseudo3_N2E3:AO353_15110
MPVQPLTRPDPARDTPTPGAGKKSIFAVVLGNAVEFFDFGVYATFAVMIGHTFFPSDSAF
VSLMLSVIAFGTGFIVRPLGAVLIGAYADRVGRKPAMLLTLVMMAVGTGSIAILPGYETI
GIAAPILLVVTRMIQGLAWGGEAGPATTYILEAAPPHKRGTYACWQVVAQGVAAMVAGLV
GFTLTKVLSPEDLNSWGWRVPFVFGLLVLPIGIYIRRNLAETFHGHTEQTRTGDLVREIV
GKHRRALVLGLLILSGSTITQYFLNYMTTFALTELKLPTSIAMLSTLVAGAAMAVCAVAG
GMLCDRFGRRVILMTPRVVLLLILFPALQLMTEHPSSATFLLTLAVLSGLHGMSGAALIV
LLVESFPKSVRATGFSIVYAFGVAAFGGTAQIIITWLIGTTGDPMSPVWYLLIANLVCLT
AAWFAKETRPLLPERPARETRLAEAQVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory