Comparing AO353_15560 FitnessBrowser__pseudo3_N2E3:AO353_15560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
46% identity, 100% coverage: 1:210/211 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
46% identity, 100% coverage: 1:210/211 of query aligns to 1:211/212 of O86043
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
46% identity, 100% coverage: 1:210/211 of query aligns to 3:213/214 of 2v6kA
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
42% identity, 99% coverage: 3:211/211 of query aligns to 5:208/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
42% identity, 99% coverage: 3:211/211 of query aligns to 8:211/216 of Q9WVL0
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
42% identity, 99% coverage: 3:211/211 of query aligns to 4:207/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
42% identity, 99% coverage: 3:211/211 of query aligns to 8:211/216 of O43708
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
41% identity, 100% coverage: 1:211/211 of query aligns to 8:213/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
41% identity, 100% coverage: 1:211/211 of query aligns to 10:215/222 of 4kdyA
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
36% identity, 100% coverage: 1:211/211 of query aligns to 4:224/228 of 3n5oA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
36% identity, 100% coverage: 1:211/211 of query aligns to 6:226/231 of D2YW48
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
36% identity, 100% coverage: 1:211/211 of query aligns to 3:215/216 of 4pxoA
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
27% identity, 99% coverage: 4:211/211 of query aligns to 4:212/219 of 3qawA
3ublA Crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound
29% identity, 71% coverage: 14:163/211 of query aligns to 16:152/212 of 3ublA
Sites not aligning to the query:
4kh7B Crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione
27% identity, 93% coverage: 6:201/211 of query aligns to 9:205/212 of 4kh7B
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
24% identity, 94% coverage: 1:198/211 of query aligns to 3:192/202 of 4g9hA
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
26% identity, 86% coverage: 17:198/211 of query aligns to 16:190/201 of 1f2eA
Sites not aligning to the query:
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
25% identity, 89% coverage: 1:187/211 of query aligns to 1:179/202 of 2gdrA
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
25% identity, 89% coverage: 1:187/211 of query aligns to 1:179/200 of 2dsaA
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
27% identity, 96% coverage: 3:204/211 of query aligns to 6:199/215 of 4chsA
>AO353_15560 FitnessBrowser__pseudo3_N2E3:AO353_15560
MELFTYYRSTSSFRVRIALALKGLEYQALPINLIAPQGGEHQQPAYLHINPQGRVPALRT
DEGELLIQSPAIIEYLEERYPQVPLLSKDLARRAHERGVAALIGCDIHPLHNVSVLNQLR
QLGHDEPQVVHWIGHWITQGLAAVEHLIGDEGYCFGNAPGLADVYLIPQLYAAERFNISL
EAYPRIRRVAALAVQHPAFIKAHPANQPDTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory