SitesBLAST
Comparing AO353_15695 FitnessBrowser__pseudo3_N2E3:AO353_15695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
64% identity, 99% coverage: 1:512/519 of query aligns to 4:512/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G151), G156 (= G153), K165 (= K162), N182 (= N179), E185 (= E182), G273 (= G270), E274 (= E271), E275 (= E272), N309 (≠ H306), N310 (= N307), S313 (≠ T310), A490 (= A490), M491 (≠ L491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A155), F160 (= F157), K165 (= K162), T168 (= T165), E275 (= E272), L295 (≠ I292)
- binding iron/sulfur cluster: V271 (≠ I268), V289 (= V286), S442 (= S439), C443 (= C440), G444 (= G441), K445 (= K442), C446 (= C443), C449 (= C446), L488 (= L488), C489 (= C489), M491 (≠ L491), G492 (= G492)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
61% identity, 98% coverage: 3:510/519 of query aligns to 2:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G151), R147 (= R152), G148 (= G153), N174 (= N179), D176 (= D181), E177 (= E182), Y254 (= Y267), G257 (= G270), E258 (= E271), N293 (≠ H306), N294 (= N307), S297 (≠ T310)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F157), K157 (= K162), E258 (= E271), E259 (= E272), L279 (≠ I292), K466 (≠ Q484), L470 (= L488)
- binding iron/sulfur cluster: S426 (= S439), C427 (= C440), G428 (= G441), T429 (≠ K442), C430 (= C443), C433 (= C446), L470 (= L488), C471 (= C489), G474 (= G492)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
39% identity, 95% coverage: 16:510/519 of query aligns to 56:555/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C82 (≠ S42), F85 (≠ L45), C86 (≠ Y46)
- binding flavin mononucleotide: G201 (= G153), N227 (= N179), E230 (= E182), N355 (= N307), G535 (≠ A490), L536 (= L491)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E272), R337 (≠ K289), R340 (≠ I292), T341 (≠ P293), N342 (≠ A294), S433 (≠ L385)
- binding iron/sulfur cluster: S487 (= S439), C488 (= C440), G489 (= G441), C491 (= C443), C494 (= C446), C534 (= C489), L536 (= L491), G537 (= G492)
- binding zinc ion: C471 (≠ D423)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
39% identity, 97% coverage: 10:510/519 of query aligns to 9:509/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ L11), C41 (≠ S42), C45 (≠ Y46)
- binding flavin mononucleotide: R154 (= R152), K164 (= K162), N181 (= N179), F269 (≠ Y267), E273 (= E271), E274 (= E272), I307 (≠ V305), N308 (≠ H306), N309 (= N307), G489 (≠ A490), L490 (= L491)
- binding nicotinamide-adenine-dinucleotide: G155 (= G153), G156 (= G154), F159 (= F157), F163 (≠ I161), E273 (= E271), E274 (= E272), K291 (= K289), F294 (≠ I292), G413 (= G411)
- binding iron/sulfur cluster: P288 (≠ V286), C442 (= C440), G443 (= G441), C445 (= C443), C448 (= C446), C488 (= C489), L490 (= L491), G491 (= G492)
- binding zinc ion: C425 (≠ D423)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
40% identity, 92% coverage: 35:510/519 of query aligns to 41:524/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (≠ S42), F49 (≠ R43), L51 (= L45), C52 (≠ Y46)
- binding flavin mononucleotide: G166 (= G151), G168 (= G153), N196 (= N179), D198 (= D181), F284 (≠ Y267), G287 (= G270), E288 (= E271), E289 (= E272), N324 (= N307)
- binding iron/sulfur cluster: C457 (= C440), G458 (= G441), K459 (= K442), C460 (= C443), C463 (= C446), C503 (= C489), G506 (= G492)
- binding zinc ion: C440 (≠ D423)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
40% identity, 98% coverage: 3:510/519 of query aligns to 27:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P7), G33 (≠ D9), T34 (≠ S10), C36 (≠ A12), C67 (≠ S42), C68 (≠ R43), G69 (= G44), R70 (≠ L45), C71 (≠ Y46)
- binding flavin mononucleotide: G185 (= G151), R186 (= R152), G187 (= G153), N213 (= N179), D215 (= D181), E216 (= E182), G217 (= G183), F301 (≠ Y267), G304 (= G270), E305 (= E271), E306 (= E272), N340 (≠ H306), N341 (= N307), G521 (≠ A490), L522 (= L491)
- binding iron/sulfur cluster: P320 (≠ V286), S473 (= S439), C474 (= C440), G475 (= G441), K476 (= K442), C477 (= C443), C480 (= C446), L519 (= L488), C520 (= C489), L522 (= L491), G523 (= G492)
- binding zinc ion: C457 (≠ D423)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
44% identity, 76% coverage: 116:510/519 of query aligns to 1:395/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G151), G39 (= G153), N67 (= N179), G158 (= G270), E159 (= E271), E160 (= E272), G375 (≠ A490)
- binding nicotinamide-adenine-dinucleotide: G40 (= G154), F43 (= F157), K48 (= K162), R177 (≠ K289), F180 (≠ I292), M297 (= M409)
- binding iron/sulfur cluster: S327 (= S439), C328 (= C440), G329 (= G441), K330 (= K442), C331 (= C443), C334 (= C446), L373 (= L488), C374 (= C489)
- binding zinc ion: C311 (≠ D423)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
46% identity, 68% coverage: 157:510/519 of query aligns to 20:372/447 of 8a5eB
- binding flavin mononucleotide: N44 (= N179), G135 (= G270), E137 (= E272), N171 (≠ H306), N172 (= N307), G352 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F20 (= F157), K25 (= K162), F28 (≠ T165), D49 (= D184), R154 (≠ K289), F157 (≠ I292), S250 (≠ L385)
- binding iron/sulfur cluster: P151 (≠ V286), C305 (= C440), G306 (= G441), K307 (= K442), C308 (= C443), C311 (= C446), C351 (= C489), G354 (= G492)
- binding zinc ion: C288 (≠ D423)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 79% coverage: 100:510/519 of query aligns to 2:410/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D423), C364 (≠ L461)
- binding flavin mononucleotide: G54 (= G151), G56 (= G153), K65 (= K162), N82 (= N179), D84 (= D181), E85 (= E182), G173 (= G270), E175 (= E272), N210 (= N307), G390 (≠ A490), L391 (= L491)
- binding nicotinamide-adenine-dinucleotide: G56 (= G153), G57 (= G154), A58 (= A155), F60 (= F157), K65 (= K162), F68 (≠ T165), E85 (= E182), E175 (= E272), R192 (≠ K289), F195 (≠ I292), I312 (≠ M409), M313 (≠ L410), S315 (≠ H412)
- binding iron/sulfur cluster: S342 (= S439), C343 (= C440), G344 (= G441), C346 (= C443), C349 (= C446), S387 (= S487), C389 (= C489), L391 (= L491), G392 (= G492)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 79% coverage: 100:510/519 of query aligns to 2:410/425 of 7t2rB
Sites not aligning to the query:
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
42% identity, 79% coverage: 102:510/519 of query aligns to 13:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G151), K74 (= K162), N91 (= N179), D93 (= D181), Y179 (= Y267), G182 (= G270), E183 (= E271), N218 (≠ H306), N219 (= N307), L401 (= L491)
- binding iron/sulfur cluster: I180 (= I268), P198 (≠ V286), S351 (= S439), C352 (= C440), G353 (= G441), K354 (= K442), C355 (= C443), C358 (= C446), F398 (≠ L488), C399 (= C489), L401 (= L491)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
42% identity, 79% coverage: 102:510/519 of query aligns to 13:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G151), G65 (= G153), N91 (= N179), D93 (= D181), G182 (= G270), E183 (= E271), E184 (= E272), N218 (≠ H306), N219 (= N307), T222 (= T310), P400 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G153), G66 (= G154), F69 (= F157), K74 (= K162), F77 (≠ T165), E96 (≠ D184), Y179 (= Y267), E184 (= E272), K201 (= K289), F204 (≠ I292), T324 (≠ H412)
- binding iron/sulfur cluster: S351 (= S439), C352 (= C440), K354 (= K442), C355 (= C443), C358 (= C446), F398 (≠ L488), C399 (= C489), L401 (= L491), A402 (≠ G492)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
42% identity, 79% coverage: 102:510/519 of query aligns to 14:421/438 of Q56222
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
39% identity, 83% coverage: 82:510/519 of query aligns to 8:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G151), G63 (= G153), K72 (= K162), N90 (= N179), D92 (= D181), G181 (= G270), E182 (= E271), N217 (≠ H306), N218 (= N307), A399 (= A490), H400 (≠ L491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G153), G64 (= G154), A65 (= A155), F67 (= F157), K72 (= K162), L75 (≠ T165), E95 (≠ D184), Y178 (= Y267), E183 (= E272), F203 (≠ I292), R320 (≠ M409), T323 (≠ H412)
- binding iron/sulfur cluster: S350 (= S439), C351 (= C440), W353 (≠ K442), C354 (= C443), C357 (= C446), F397 (≠ L488), C398 (= C489), H400 (≠ L491)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
42% identity, 77% coverage: 113:510/519 of query aligns to 15:417/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G151), R54 (= R152), G55 (= G153), A57 (= A155), K64 (= K162), N90 (= N179), D92 (= D181), Y178 (= Y267), G181 (= G270), E182 (= E271), E183 (= E272), N217 (≠ H306), N218 (= N307), S221 (≠ T310), L398 (= L491)
- binding iron/sulfur cluster: P197 (≠ V286), S349 (= S439), C350 (= C440), G351 (= G441), K352 (= K442), C353 (= C443), C356 (= C446), S394 (= S487), F395 (≠ L488), C396 (= C489), L398 (= L491), G399 (= G492)
- binding zinc ion: C333 (≠ D423), E371 (≠ P464)
Sites not aligning to the query:
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
38% identity, 80% coverage: 97:510/519 of query aligns to 10:413/419 of 6saqB
- binding flavin mononucleotide: G64 (= G151), G66 (= G153), K75 (= K162), N91 (= N179), D93 (= D181), E94 (= E182), Y179 (= Y267), G182 (= G270), E183 (= E271), N218 (≠ H306), N219 (= N307), T222 (= T310)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G153), G67 (= G154), A68 (= A155), F70 (= F157), K75 (= K162), E94 (= E182), E96 (≠ D184), T99 (= T187), E184 (= E272), Y204 (≠ I292), T318 (≠ H412)
- binding iron/sulfur cluster: P198 (≠ V286), T345 (≠ S439), C346 (= C440), G347 (= G441), Q348 (≠ K442), C349 (= C443), C352 (= C446), I391 (≠ L488), C392 (= C489), G395 (= G492)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
38% identity, 80% coverage: 97:510/519 of query aligns to 11:414/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G151), G67 (= G153), K76 (= K162), N92 (= N179), E95 (= E182), Y180 (= Y267), G183 (= G270), E184 (= E271), V218 (= V305), N219 (≠ H306), N220 (= N307), T223 (= T310)
- binding iron/sulfur cluster: T346 (≠ S439), C347 (= C440), G348 (= G441), Q349 (≠ K442), C350 (= C443), C353 (= C446), S391 (= S487), I392 (≠ L488), C393 (= C489), G396 (= G492)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
38% identity, 80% coverage: 97:510/519 of query aligns to 9:412/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G151), G65 (= G153), K74 (= K162), N90 (= N179), D92 (= D181), E93 (= E182), G181 (= G270), E182 (= E271), E183 (= E272), V216 (= V305), N217 (≠ H306), N218 (= N307), T221 (= T310)
- binding nicotinamide-adenine-dinucleotide: G65 (= G153), G66 (= G154), A67 (= A155), F69 (= F157), K74 (= K162), E95 (≠ D184), Y178 (= Y267), E183 (= E272), K200 (= K289), Y203 (≠ I292)
- binding iron/sulfur cluster: I179 (= I268), P197 (≠ V286), T344 (≠ S439), C345 (= C440), G346 (= G441), Q347 (≠ K442), C348 (= C443), C351 (= C446), S389 (= S487), I390 (≠ L488), C391 (= C489), L393 (= L491), G394 (= G492)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
38% identity, 80% coverage: 97:510/519 of query aligns to 10:413/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G151), G66 (= G153), K75 (= K162), N91 (= N179), D93 (= D181), E94 (= E182), G182 (= G270), E183 (= E271), E184 (= E272), V217 (= V305), N218 (≠ H306), N219 (= N307), T222 (= T310), G393 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G153), G67 (= G154), A68 (= A155), F70 (= F157), K75 (= K162), E94 (= E182), E96 (≠ D184), Y179 (= Y267), E184 (= E272), Y204 (≠ I292)
- binding iron/sulfur cluster: P198 (≠ V286), T345 (≠ S439), C346 (= C440), G347 (= G441), Q348 (≠ K442), C349 (= C443), C352 (= C446), I391 (≠ L488), C392 (= C489), L394 (= L491), G395 (= G492)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
37% identity, 79% coverage: 98:506/519 of query aligns to 8:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G151), R61 (= R152), G62 (= G153), K71 (= K162), N89 (= N179), D91 (= D181), Y177 (= Y267), G180 (= G270), E181 (= E271), E182 (= E272), T216 (≠ H306), N217 (= N307)
- binding iron/sulfur cluster: S351 (= S439), C352 (= C440), G353 (= G441), Q354 (≠ K442), C355 (= C443), C358 (= C446), T396 (≠ S487), C398 (= C489), L400 (= L491)
Query Sequence
>AO353_15695 FitnessBrowser__pseudo3_N2E3:AO353_15695
MPSLYLPCDSLARAVGADEVAVALATQARERNLPLDLQRTSSRGLYWLEPLLEMDTPQGR
IGFGPLTAADVPSLLDALQGEPSAHPLALGLVEELPYLKSQQRLLFARAGITRPLSLDDY
RAHGGFEGLTQAIALGGEQTATAVFDSGLRGRGGAAFPAGIKWRTVRGTQAAQKYIVCNA
DEGDSGTFADRMLMEGDPFLLIEGMAIAGITVGASYGYIYVRSEYPQAVATLREALDIAR
AAGYLGANVGGSGLAFDMEVRVGAGAYICGEETALLDSLEGKRGIVRAKPPIPALQGLFG
LPTLVHNVLTLASVPMIMAKGAQFYRDYGMGRSLGTMPFQLAGNVRHGGLVERAFGLTLR
ELVEEYGGGTASGRPLKAAQVGGPLGAWVPPGQFDTPLDYEAFAAIGAMLGHGGVVVADD
SLDMAHMARFAMQFCAEESCGKCTPCRIGSTRGVEVIDRLLAAPDQSSRDEQVIILKDLC
DTLQYGSLCALGGMTSYPVVSALKYFPADFGLQASEADQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory