Comparing AO353_15825 FitnessBrowser__pseudo3_N2E3:AO353_15825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
47% identity, 62% coverage: 8:168/258 of query aligns to 80:240/257 of 1ssqD
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
46% identity, 65% coverage: 8:174/258 of query aligns to 84:250/262 of 1t3dA
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
43% identity, 64% coverage: 5:168/258 of query aligns to 81:244/250 of 4hzdA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
45% identity, 63% coverage: 8:170/258 of query aligns to 80:242/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
45% identity, 63% coverage: 8:170/258 of query aligns to 83:245/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
45% identity, 62% coverage: 8:168/258 of query aligns to 84:244/244 of 8i06A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
44% identity, 61% coverage: 3:160/258 of query aligns to 101:258/280 of 7bw9A
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
46% identity, 62% coverage: 8:168/258 of query aligns to 80:240/258 of 4h7oA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
44% identity, 65% coverage: 8:174/258 of query aligns to 87:253/272 of 3gvdI
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
40% identity, 64% coverage: 8:171/258 of query aligns to 85:248/261 of 6wyeA
1sstA Serine acetyltransferase- complex with coa (see paper)
46% identity, 62% coverage: 8:168/258 of query aligns to 80:233/233 of 1sstA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
41% identity, 62% coverage: 8:166/258 of query aligns to 83:241/243 of 7ra4A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
41% identity, 62% coverage: 8:168/258 of query aligns to 83:243/243 of 4n69A
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
39% identity, 60% coverage: 5:160/258 of query aligns to 105:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
39% identity, 60% coverage: 5:160/258 of query aligns to 103:266/267 of 3q1xA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
37% identity, 64% coverage: 5:168/258 of query aligns to 58:233/233 of 4n6bA
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 43% coverage: 58:168/258 of query aligns to 25:152/191 of G3XD01
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
35% identity, 32% coverage: 85:167/258 of query aligns to 58:140/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
30% identity, 36% coverage: 86:178/258 of query aligns to 47:152/290 of 4mzuB
Sites not aligning to the query:
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
31% identity, 40% coverage: 65:168/258 of query aligns to 32:152/191 of 3mqhA
Sites not aligning to the query:
>AO353_15825 FitnessBrowser__pseudo3_N2E3:AO353_15825
MFERLREDIQSVFHRDPAARNAFEVLTCYPGMHAIWIHRLSAALWGMGWKWLARLVSNFG
RWLTGIEIHPGAKVGRRFFIDHGMGIVIGETAEIGNDVTLYQGVTLGGTSWNKGKRHPTL
EDGVVVGAGAKVLGPFTVGAGAKVGSNAVVTKAVPAGATVVGIPGRIIVKSDDELEARRK
AMAEKIGFDAYGVSEDMPDPVARAIGQLLDHLQAVDGRLEGMCGALKDLGSPYCAKDLPE
LREEDFACVKGKDESQAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory