SitesBLAST
Comparing AO353_15985 FitnessBrowser__pseudo3_N2E3:AO353_15985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
58% identity, 99% coverage: 4:547/549 of query aligns to 4:554/555 of 5brpA
- active site: D96 (= D96), Q196 (≠ R190), D198 (= D192), E249 (= E242), H323 (= H316), D324 (= D317)
- binding magnesium ion: D19 (≠ S19), T21 (≠ A21), N23 (= N23), V25 (≠ T25), D27 (= D27)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D58), N59 (= N59), Y61 (= Y61), H101 (= H101), Y162 (≠ F156), D198 (= D192), V199 (= V193), E249 (= E242)
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
46% identity, 99% coverage: 4:546/549 of query aligns to 5:550/553 of 5do8B
- active site: D97 (= D96), R193 (= R190), D195 (= D192), E252 (= E242), H325 (= H316), D326 (= D317)
- binding beta-D-glucopyranose: D59 (= D58), Y62 (= Y61), H102 (= H101), F159 (= F156), R193 (= R190), D195 (= D192), E252 (= E242), H325 (= H316), D326 (= D317), R411 (= R402)
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
45% identity, 98% coverage: 4:543/549 of query aligns to 5:557/561 of O06994
- D20 (≠ S19) binding
- N22 (≠ A21) binding
- D24 (≠ N23) binding
- F26 (≠ T25) binding
- D28 (= D27) binding
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
45% identity, 98% coverage: 4:543/549 of query aligns to 3:552/556 of 5wczA
- active site: D95 (= D96), R195 (= R190), D197 (= D192), E250 (= E242), H326 (= H316), D327 (= D317)
- binding 1-deoxynojirimycin: D57 (= D58), Y60 (= Y61), H100 (= H101), F161 (= F156), D197 (= D192), V198 (= V193), E250 (= E242), H326 (= H316), D327 (= D317), R413 (= R402)
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
45% identity, 98% coverage: 4:543/549 of query aligns to 3:555/559 of 7lv6B
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
45% identity, 98% coverage: 4:543/549 of query aligns to 3:555/559 of 4mazA
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
46% identity, 98% coverage: 4:543/549 of query aligns to 3:551/555 of 4m56A
- active site: D95 (= D96), R195 (= R190), D197 (= D192), E250 (= E242), H326 (= H316), D327 (= D317)
- binding D-glucose: D57 (= D58), Y60 (= Y61), H100 (= H101), F142 (= F137), D197 (= D192), E250 (= E242), D327 (= D317), R413 (= R402)
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
44% identity, 98% coverage: 4:543/549 of query aligns to 4:533/537 of 4aieA
4wlcA Structure of dextran glucosidase with glucose (see paper)
44% identity, 99% coverage: 4:546/549 of query aligns to 6:535/536 of 4wlcA
- active site: D98 (= D96), R192 (= R190), D194 (= D192), Q236 (≠ E242), H312 (= H316), D313 (= D317)
- binding beta-D-glucopyranose: D60 (= D58), Y63 (= Y61), H103 (= H101), F158 (= F156), D194 (= D192), H312 (= H316), D313 (= D317), R398 (= R402)
- binding calcium ion: D21 (≠ S19), N23 (≠ A21), D25 (≠ N23), I27 (≠ T25), D29 (= D27), D148 (≠ A146), D151 (≠ G149)
2zidA Crystal structure of dextran glucosidase e236q complex with isomaltotriose (see paper)
44% identity, 99% coverage: 4:546/549 of query aligns to 6:535/536 of 2zidA
- active site: D98 (= D96), R192 (= R190), D194 (= D192), Q236 (≠ E242), H312 (= H316), D313 (= D317)
- binding calcium ion: D21 (≠ S19), N23 (≠ A21), D25 (≠ N23), I27 (≠ T25), D29 (= D27), D148 (≠ A146), D151 (≠ G149)
- binding alpha-D-glucopyranose: D60 (= D58), Y63 (= Y61), H103 (= H101), F139 (= F137), F158 (= F156), D194 (= D192), V195 (= V193), Q236 (≠ E242), Q236 (≠ E242), W238 (≠ S244), K275 (= K280), H312 (= H316), D313 (= D317), E371 (= E375), R398 (= R402), R398 (= R402)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
42% identity, 99% coverage: 4:547/549 of query aligns to 4:546/546 of 8ibkA
- binding calcium ion: D19 (≠ S19), N21 (≠ A21), D23 (≠ N23), I25 (≠ T25), D27 (= D27), E528 (≠ V529), T534 (≠ F535)
- binding alpha-D-glucopyranose: D58 (= D58), Y61 (= Y61), H101 (= H101), I141 (≠ K136), F161 (= F156), D197 (= D192), A198 (≠ V193), H201 (≠ L196), M227 (≠ T215), Q254 (≠ E242), Q254 (≠ E242), F280 (= F268), H320 (= H316), D321 (= D317), R405 (= R402)
2ze0A Alpha-glucosidase gsj (see paper)
45% identity, 98% coverage: 4:543/549 of query aligns to 5:526/531 of 2ze0A
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
42% identity, 99% coverage: 4:547/549 of query aligns to 7:558/559 of 4howA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
42% identity, 99% coverage: 4:547/549 of query aligns to 7:558/559 of 4hphA
- active site: D99 (= D96), R198 (= R190), D200 (= D192), Q254 (≠ E242), H327 (= H316), D328 (= D317)
- binding calcium ion: D22 (≠ S19), N24 (≠ A21), D26 (≠ N23), I28 (≠ T25), D30 (= D27)
- binding beta-D-fructofuranose: F164 (= F156), Q254 (≠ E242), F256 (≠ S244), D328 (= D317), E387 (= E375), R415 (= R402)
- binding alpha-D-glucopyranose: D61 (= D58), Y64 (= Y61), H104 (= H101), F164 (= F156), D200 (= D192), Q254 (≠ E242), H327 (= H316), D328 (= D317), R415 (= R402)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
42% identity, 99% coverage: 4:547/549 of query aligns to 7:558/559 of 4hozA
- active site: D99 (= D96), R198 (= R190), A200 (≠ D192), E254 (= E242), H327 (= H316), D328 (= D317)
- binding calcium ion: D22 (≠ S19), N24 (≠ A21), D26 (≠ N23), I28 (≠ T25), D30 (= D27)
- binding alpha-D-glucopyranose: D61 (= D58), Y64 (= Y61), H104 (= H101), F164 (= F156), R198 (= R190), A200 (≠ D192), E254 (= E242), H327 (= H316), D328 (= D317), R415 (= R402)
3gbeA Crystal structure of the isomaltulose synthase smua from protaminobacter rubrum in complex with the inhibitor deoxynojirimycin (see paper)
41% identity, 99% coverage: 4:547/549 of query aligns to 6:557/558 of 3gbeA
- active site: D98 (= D96), R197 (= R190), D199 (= D192), E253 (= E242), H326 (= H316), D327 (= D317)
- binding 1-deoxynojirimycin: D60 (= D58), Y63 (= Y61), H103 (= H101), F163 (= F156), R197 (= R190), D199 (= D192), H326 (= H316), D327 (= D317), R414 (= R402)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
42% identity, 94% coverage: 4:517/549 of query aligns to 6:529/556 of 2pwgA
- active site: D98 (= D96), R197 (= R190), D199 (= D192), E253 (= E242), H325 (= H316), D326 (= D317)
- binding calcium ion: D21 (≠ S19), N23 (≠ A21), D25 (≠ N23), I27 (≠ T25), D29 (= D27)
- binding castanospermine: D60 (= D58), Y63 (= Y61), H103 (= H101), F163 (= F156), D199 (= D192), E253 (= E242), D326 (= D317), R413 (= R402)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
42% identity, 94% coverage: 4:517/549 of query aligns to 7:530/557 of 4h8vA
- active site: D99 (= D96), R198 (= R190), D200 (= D192), E254 (= E242), H326 (= H316), D327 (= D317)
- binding calcium ion: D22 (≠ S19), N24 (≠ A21), D26 (≠ N23), I28 (≠ T25), D30 (= D27)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D58), Y64 (= Y61), H104 (= H101), F164 (= F156), D200 (= D192), E254 (= E242), F256 (≠ S244), R284 (≠ K272), R291 (≠ K280), H326 (= H316), D327 (= D317), E386 (= E375), R414 (= R402)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
42% identity, 94% coverage: 4:517/549 of query aligns to 7:530/557 of 2pwdA
- active site: D99 (= D96), R198 (= R190), D200 (= D192), E254 (= E242), H326 (= H316), D327 (= D317)
- binding calcium ion: D22 (≠ S19), N24 (≠ A21), D26 (≠ N23), I28 (≠ T25), D30 (= D27)
- binding 1-deoxynojirimycin: D61 (= D58), Y64 (= Y61), H104 (= H101), F164 (= F156), D200 (= D192), E254 (= E242), H326 (= H316), D327 (= D317), R414 (= R402)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
42% identity, 94% coverage: 4:517/549 of query aligns to 6:529/556 of 2pweA
- active site: D98 (= D96), R197 (= R190), D199 (= D192), Q253 (≠ E242), H325 (= H316), D326 (= D317)
- binding calcium ion: D21 (≠ S19), N23 (≠ A21), D25 (≠ N23), I27 (≠ T25), D29 (= D27)
- binding beta-D-fructofuranose: F163 (= F156), Q253 (≠ E242), F255 (≠ S244), D326 (= D317), R413 (= R402)
- binding alpha-D-glucopyranose: D60 (= D58), Y63 (= Y61), H103 (= H101), F163 (= F156), D199 (= D192), Q253 (≠ E242), H325 (= H316), D326 (= D317), R413 (= R402)
Query Sequence
>AO353_15985 FitnessBrowser__pseudo3_N2E3:AO353_15985
MQDWQRSVIYQIYPKSFHSHAGNPTGDLLGVVAKLDYLQWLGVDCLWITPFLRSPQRDNG
YDISDYYAIDPSYGTMADCELLIAEAGKRGIKLMLDIVVNHTSIEHSWFQQARSSLDNPY
RDFYIWRDQPNNWESKFGGSAWEYEAQTGQYFLHLFDHTQADLNWDNPQVRAEVFKLMRF
WRDKGVGGFRLDVINLISKPADFPEDHTDGRRFYTDGPNVHEYLQEMHREVFEGHDLINV
GEMSSTSLEHCIRYSRPDSKELSMTFNFHHLKVDYPNMQKWVRADFDFLELKRILSDWQT
GMQAGGGWNALFWCNHDQPRVVSRFGDDGEHRVVSAKMLGTALHFLQGTPFIYQGEELGM
TNPGFERIEQYRDVETLNIYRLKREAGESEASSMAAIMQKSRDNSRTPMQWSALPNAGFS
SSEPWIGVPANAMQINVENQLDDTTSVLHHYRQLIALRRSEPLIQDGVYRQLLPTHKQVW
VYLREGEGERLLVVNNFYGTACEVELPERVITDCMLQRLVISNYPDSEVRKQQLFLRPYE
SFVLHLTDH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory