Comparing AO353_17220 FitnessBrowser__pseudo3_N2E3:AO353_17220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
22% identity, 77% coverage: 48:379/431 of query aligns to 32:381/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 36% coverage: 74:230/431 of query aligns to 98:259/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 52% coverage: 5:227/431 of query aligns to 21:237/444 of Q8NLB7
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 36% coverage: 82:236/431 of query aligns to 90:229/582 of O23492
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 44% coverage: 47:236/431 of query aligns to 75:247/514 of Q9LT15
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
27% identity, 44% coverage: 47:236/431 of query aligns to 55:227/487 of 7aaqA
Sites not aligning to the query:
>AO353_17220 FitnessBrowser__pseudo3_N2E3:AO353_17220
MTTITSLYTAEERGKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDNPTVQLVN
TAGVFAAGFLMRPIGGWLFGRVADKHGRKNSMMISVLMMCAGSLLIACLPTYKDIGVWAP
LLLLVARLIQGVSVGGEYGTTATYMSEVALKGQRGFFASFQYVTLIGGQLLAVSLVVILQ
QFLTEDDLRAWGWRIPFVVGAAAALISLFLRRSLKETTSKEMRENKDAGSMAALFRNNTA
AFITVLGFTAGGSLIFYTFTTYMQKYLVNTAGMPAKTASYIMTGALFLYMCMQPLFGTLA
DKIGRRNSMLWFGALGTLFTVPILLTLKSVTNPFLAFGLITVALAIVSFYTSISGLVKAE
MFPPQVRALGVGLAYAVANAIFGGSAEYVALSLKSVGIENSFYWYVTAMMAIAFLFSLRL
PRQAAYLENEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory