Comparing AO353_17230 FitnessBrowser__pseudo3_N2E3:AO353_17230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
49% identity, 94% coverage: 10:260/266 of query aligns to 10:259/261 of 2xuaH
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 99% coverage: 3:266/266 of query aligns to 3:262/262 of 6eb3C
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 99% coverage: 3:266/266 of query aligns to 3:268/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 99% coverage: 3:266/266 of query aligns to 3:265/265 of 6eb3A
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 75% coverage: 22:221/266 of query aligns to 27:227/278 of 4uhfA
Sites not aligning to the query:
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 75% coverage: 22:221/266 of query aligns to 27:227/272 of 4uheA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 75% coverage: 22:221/266 of query aligns to 27:227/274 of 4uhdA
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
24% identity, 97% coverage: 3:260/266 of query aligns to 4:266/269 of 5h3hB
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
24% identity, 78% coverage: 24:230/266 of query aligns to 21:234/269 of O07015
Sites not aligning to the query:
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
26% identity, 86% coverage: 23:250/266 of query aligns to 71:305/318 of Q10QA5
6brtA F-box protein cth with hydrolase (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 38:272/285 of 6brtA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 17:251/264 of 5zhsA
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 21:255/268 of 4ihaA
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 18:252/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 18:252/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 18:252/265 of 5yz7A
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 19:253/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
26% identity, 86% coverage: 23:250/266 of query aligns to 19:253/266 of 5dj5A
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
25% identity, 95% coverage: 8:260/266 of query aligns to 7:269/271 of 3heaA
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
25% identity, 95% coverage: 8:260/266 of query aligns to 7:269/276 of 8pi1B
Sites not aligning to the query:
>AO353_17230 FitnessBrowser__pseudo3_N2E3:AO353_17230
VGFVQLADGELKYQLDGPEHAPVLVLSNSLGTNLHMWDVQIPAFTKHFRVLRFDTRGHGR
SLVTPGPYSIEQLGRDVLALLDALNIERAHFCGLSMGGLIGQWLGINAGERLHKLVVCNT
AAKIGDPSVWNPRIETVLRDGPAAMVALRDASIARWFTPDFAQANPAVAKQITDMLAATS
PQGYAANCAAVRDADFREQLASITVPTLVIAGTEDAVTPPSGGRFIQERVRGAEYAEFYA
AHLSNVQAGSAFSDRVLSFLLAEKSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory