Comparing AO353_17375 FitnessBrowser__pseudo3_N2E3:AO353_17375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
63% identity, 96% coverage: 29:763/763 of query aligns to 2:733/733 of 6r5nA
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
63% identity, 96% coverage: 29:763/763 of query aligns to 2:733/733 of 6r5iA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
63% identity, 96% coverage: 29:763/763 of query aligns to 2:733/733 of 6r5tA
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
63% identity, 96% coverage: 29:763/763 of query aligns to 2:730/730 of 6r5vA
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
63% identity, 96% coverage: 29:763/763 of query aligns to 2:730/730 of 6r5oA
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
51% identity, 96% coverage: 31:763/763 of query aligns to 3:735/742 of 3u48B
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
48% identity, 96% coverage: 28:762/763 of query aligns to 1:733/733 of 5tf0A
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
46% identity, 96% coverage: 28:762/763 of query aligns to 3:746/749 of 5xxmA
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
46% identity, 96% coverage: 31:762/763 of query aligns to 3:735/744 of 5xxnA
4zoaA Crystal structure of beta-glucosidase from listeria innocua in complex with isofagomine (see paper)
42% identity, 95% coverage: 34:755/763 of query aligns to 6:704/716 of 4zoaA
4zobA Crystal structure of beta-glucosidase from listeria innocua in complex with gluconolactone (see paper)
41% identity, 95% coverage: 34:755/763 of query aligns to 6:710/722 of 4zobA
4zo7A Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with gentiobiose (see paper)
42% identity, 95% coverage: 34:755/763 of query aligns to 6:712/724 of 4zo7A
4zo6B Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with cellobiose (see paper)
42% identity, 95% coverage: 34:755/763 of query aligns to 6:712/724 of 4zo6B
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
37% identity, 96% coverage: 26:755/763 of query aligns to 10:722/753 of 7zgzX
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
37% identity, 96% coverage: 26:755/763 of query aligns to 10:733/765 of 7zb3A
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
37% identity, 96% coverage: 26:755/763 of query aligns to 10:733/763 of 7zdyW
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
37% identity, 96% coverage: 26:755/763 of query aligns to 10:742/772 of 8c7fA
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
36% identity, 91% coverage: 70:763/763 of query aligns to 57:756/756 of 5z87A
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
34% identity, 96% coverage: 34:762/763 of query aligns to 5:764/765 of 5z9sA
7eapA Crystal structure of ipea-xxxg complex (see paper)
33% identity, 96% coverage: 26:755/763 of query aligns to 11:746/755 of 7eapA
>AO353_17375 FitnessBrowser__pseudo3_N2E3:AO353_17375
MKKLCLLGLAIGLASHSVWADTTPAPIENKDAFISNLMKQMTLEEKIGQLRLISIGPEMP
RELIRKEIAAGNIGGTFNSITRPENRPMQDAAMHSRLKIPMFFAYDVIHGHRTIFPIPLA
LASSWDMDAIGRSGRIAAKEAAADSLDITFAPMVDISRDPRWGRTSEGFGEDTYLVSRIA
KVMVKAYQGETPSAADSIMASVKHFALYGAVEGGRDYNTVDMSPVKMYQDYLPPYRAAID
AGAGGVMVALNSINGIPATANMWLMQDLLRKEWGFKGLAVSDHGAIFELIKHGVARDGRE
AAKLAIKAGIDMSMNDTLYGKELPGLLKSGEIQQSDIDNAVREVLGAKYDMGLFKDPYLR
IGKAEDDPADTYAENRLHRAEARDVARRSMVLLKNQNETLPLKKTAKIVLVGPLAKAPID
MMGSWAAAGKPEQSVTLLDGMTRALGDQTKLTYVRGANITEDKKVLDYLNFLNFDAPEVV
NDPRSAQVMIDEAVKAAQQADVVVAAVGESRGMSHESSSRTDLNIPANQRDLIKALKATG
KPLVLVLMNGRPLTILDEKDQADAILETWFTGTEGGNAIADVLFGDYNPSGKLPISIPRS
VGQIPTYYNHLSIGRPFTPGKPGNYTSQYFDDTTGPLFPFGYGLSYTSFSLSDMALSSTT
LNKSGKIDASVTVKNTGKRDGETVVQLYIQDVVGSMIRPLKELKNFQKVMLKAGEQKVIH
FTIDEDDLKFYNAQLKYAAEPGKFNVQIGLDSEDVTQQSFELL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory