Comparing AO353_17580 FitnessBrowser__pseudo3_N2E3:AO353_17580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
28% identity, 71% coverage: 33:266/329 of query aligns to 8:235/300 of 2dvzA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
26% identity, 67% coverage: 29:250/329 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndsA Crystal structure of tphc in a closed conformation (see paper)
22% identity, 88% coverage: 33:323/329 of query aligns to 6:289/294 of 7ndsA
7ndrD Crystal structure of tphc in an open conformation (see paper)
22% identity, 88% coverage: 33:323/329 of query aligns to 6:289/293 of 7ndrD
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 41% coverage: 130:264/329 of query aligns to 103:224/300 of 2f5xB
Sites not aligning to the query:
>AO353_17580 FitnessBrowser__pseudo3_N2E3:AO353_17580
MDLSLRKVALAASCLLFAGPLLADVAGEPKRPECIAPASPGGGFDLTCKLAQSALVNEKI
LTKPMRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDENAVRWL
AAVGTSYGAIAVKSDSPYKNLDDLVQALKKDPSKVVIGSGGTVGSQDWMQTALIAKAAGI
NPRDLRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFANERLDEPEM
KDIPTAKEQGYDIVWPVVRGFYLGPKVSDAEYAWWKNAFDKLLASEDFAKLRDQRELFPF
AMTGPELDTYVKKQVADYKLLAKEFGLIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory