Comparing AO353_17705 FitnessBrowser__pseudo3_N2E3:AO353_17705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
58% identity, 95% coverage: 7:255/263 of query aligns to 1:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
58% identity, 95% coverage: 7:255/263 of query aligns to 5:254/258 of P02915
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
53% identity, 94% coverage: 11:256/263 of query aligns to 4:238/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 94% coverage: 9:256/263 of query aligns to 4:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 94% coverage: 9:256/263 of query aligns to 4:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 94% coverage: 9:256/263 of query aligns to 4:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 94% coverage: 9:256/263 of query aligns to 4:240/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
54% identity, 94% coverage: 9:254/263 of query aligns to 3:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 94% coverage: 9:256/263 of query aligns to 2:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 94% coverage: 9:256/263 of query aligns to 3:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 94% coverage: 9:256/263 of query aligns to 3:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 94% coverage: 9:256/263 of query aligns to 3:244/344 of 3tuiC
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 84% coverage: 9:229/263 of query aligns to 4:218/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
38% identity, 86% coverage: 6:230/263 of query aligns to 1:214/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 9:259/263 of query aligns to 5:256/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
37% identity, 85% coverage: 9:232/263 of query aligns to 4:220/615 of 5lilA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 92% coverage: 1:243/263 of query aligns to 7:237/378 of P69874
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 86% coverage: 9:235/263 of query aligns to 4:224/248 of 8g4cB
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
37% identity, 85% coverage: 9:232/263 of query aligns to 4:220/592 of 5lj7A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 94% coverage: 14:259/263 of query aligns to 32:268/382 of 7ahhC
Sites not aligning to the query:
>AO353_17705 FitnessBrowser__pseudo3_N2E3:AO353_17705
MSTQPASALSVTNIQKSFGSAHVLKGISLEAHKGDVISILGASGSGKSTFLRCINLLETP
DQGIISVNGEVIEMKQHADGRQTPSNSRQVERMRSCLGMVFQSFNLWSHMTVLQNVIEGP
MRVLKRSRAECVEEAEALLHKVGLYDRRDYYPAHLSGGQQQRVAIARALAMNPQVMLFDE
PTSALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVVFMHGGLIDVQGTPTE
LFEGLPTERFRQFVSSHHERSAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory